KEGG   Halanaerobium hydrogeniformans: Halsa_1310Help
Entry
Halsa_1310        CDS       T01349                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
has  Halanaerobium hydrogeniformans
Brite
Enzymes [BR:has01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Halsa_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1476227..1477033
Genome map
AA seq 268 aa AA seqDB search
MQIKKISTETKINPLAEEIKLGFNDKSLDKAVLLLHGFAGRSNNWKYIAEKIYQQKNTAV
YVPRLPGHGSSSSDFRASNSEQWLRKSVDSYLYLKSNFEKIYLAGLSMGGLLAALLAANF
KIEKLSLIAPAFYSRDKKIALTPIGKYFIEKIDHPSAEENKEDLSEEELDYRNNYNKYYY
LEQLAELYALMKKARKEISKPKIPTQLIISKNDRTIANTKTLEFLNKKMGQSLKDIKIYQ
ESSHVITNDVEKEKCASDIIDFFFNLQN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaataaaaaaaataagtacagaaactaaaattaatcccttagctgaagaaataaaa
cttggctttaatgataaatctctagataaagcagttctgttgctccatggttttgctggc
aggagcaataactggaaatatatcgcagaaaaaatttatcagcaaaaaaatactgctgtc
tatgtaccaagactacctggtcatggaagcagctcaagtgattttagggcaagtaattca
gaacagtggctgcgcaaaagtgttgatagttatttgtatttaaaaagtaattttgaaaaa
atttaccttgccggattgtcaatgggagggctgctcgcagcattattagcagcaaatttc
aagatcgaaaagctctctttaattgctcctgctttttatagcagagataaaaaaatcgcc
ctaaccccaatcggtaaatattttattgaaaaaattgatcatccatctgcagaagaaaat
aaagaagatctttcagaagaagaactggattatagaaataattacaataaatattattat
ctcgaacagttggccgaattatatgctttgatgaaaaaggctagaaaagagatttcaaag
cccaaaataccaactcaattaataatcagcaaaaatgaccggacaattgccaatacaaag
actctggagtttttaaacaaaaaaatgggacaatctttaaaagatataaaaatatatcaa
gaatcgtcccatgtaattactaatgatgttgaaaaagaaaaatgtgcttctgatataatt
gacttctttttcaatctacaaaattag

DBGET integrated database retrieval system