KEGG   Halanaerobium hydrogeniformans: Halsa_1462Help
Entry
Halsa_1462        CDS       T01349                                 

Definition
tyrosyl-tRNA synthetase
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:has00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1627253..1628533)
Genome map
AA seq 426 aa AA seqDB search
MTKDTGGEQPVELNIRQAFFMEINEQLKILKRGVSDLISEEELKEKLIEAEKEGRPLKVK
LGLDPTAPDIHLGHTVVLRKLKQFQDLGHQVYLIIGDFTGMIGDPTGKSETRKQLTKEEV
RENALTYQEQFSKVLDRDKTKLVYNSDWLSEMKFSDVLELSAQYTVARMLERDDFSKRYK
AGKPIGIHEFFYPLMQGYDSVAIEADVELGGTDQRFNLLVGRNLQKEYGQDSQVIITMPL
LEGLDGVNKMSKSLDNYIGVYDKPADMYGKVMSMPDELIARYYELLTDISIEQLNEIKAK
LNRDDFNPMQLKKELAAELVREYHDEEAAQYAAQEFENVFSQGNLPDDIPEVKIEKSELD
EGELWIVKIVAATGLVDSNSEARRMIKQGAVTIDGEKYDKINLDLEVKDGMIVQIGKRRF
AQIKLS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggatacaggaggtgaacagcctgttgaattgaatataagacaggcgtttttt
atggaaattaatgaacagttaaaaatattgaaaagaggggtcagtgacctgatctcagaa
gaagagttaaaagaaaaattgattgaagccgaaaaagagggacgtcctctaaaagttaaa
ctgggacttgatccaactgcacctgacatccatctgggtcatactgtagttctgcgtaaa
ttaaagcagtttcaggatttaggtcatcaggtttatttaataatcggtgattttacaggt
atgataggagatccaaccggaaaatctgaaacgagaaaacagctgacaaaagaagaggtc
agagaaaatgcacttacatatcaggaacaattttcgaaggttttagatagagataaaaca
aaacttgtctataatagtgactggttgagtgaaatgaaatttagcgatgttttagaactt
tctgcccagtatactgtggccaggatgctggaaagagatgatttttccaaacgttataaa
gctggaaaaccgatcgggatccacgaatttttctatcctttaatgcagggttatgattcg
gttgcgatcgaagcagatgtagaacttggtggtactgatcagcgttttaaccttctggtt
ggtagaaacctgcagaaagaatatggtcaggattctcaggtaataataaccatgccttta
ttagaaggtttagatggagttaacaagatgagtaaaagtcttgataattatataggagtt
tatgataaaccggcagatatgtatggtaaggtaatgtcgatgcctgatgaactaattgcc
cgctattatgagcttttaacagatatttcaattgaacaattaaatgagattaaagctaaa
cttaatcgggatgattttaatccaatgcagcttaaaaaagaactggctgcagaactggtt
agagaatatcatgatgaagaagctgctcaatatgcagctcaggaatttgaaaatgtattt
tcacagggtaatttacctgatgatataccagaggtaaaaatagagaaatccgagcttgat
gagggagaactctggatagttaaaattgttgctgctacaggtctggttgattctaacagt
gaagccagaaggatgatcaaacagggtgcagtaactattgatggtgaaaaatatgataaa
ataaatttagatcttgaagtaaaagatgggatgatagttcagatcgggaaaaggcgcttt
gctcaaattaaactgagctag

DBGET integrated database retrieval system