KEGG   Halanaerobium hydrogeniformans: Halsa_1502Help
Entry
Halsa_1502        CDS       T01349                                 

Definition
1-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halsa_1502
   01230 Biosynthesis of amino acids
    Halsa_1502
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_1502
   00030 Pentose phosphate pathway
    Halsa_1502
   00051 Fructose and mannose metabolism
    Halsa_1502
   00052 Galactose metabolism
    Halsa_1502
  Energy metabolism
   00680 Methane metabolism
    Halsa_1502
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Halsa_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1683483..1684409)
Genome map
AA seq 308 aa AA seqDB search
MEKILTFTLNPTVDKSAKVDNVRVEAKLHCDTVRYEPGGGGINVSRAVKKLGGSSRLVYT
SGGFTGRKLDKLLEQEELNLKSIEIEDSIRENFIIFERASQQQYRFGMPGPKISDSEYQM
IFDIFSNIENFPEYFVISGSIPVGTDDKIYAELAGLAKKRGAKVIVDVSGPPLKAVMEEG
VFLIKPNIGEFQQLVGKELQDEEEIKKYALKFVNDSCCEMIVISIGAGGALLVYQDKAKF
MRPPTVPIKSKVGAGDSMVAGMVLSLSQGNSIENAFAYGIAAGSAAVMTPGTELCRKEDT
DRLYKSMI
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaattcttacttttacacttaatccaactgttgacaaaagcgcaaaagttgat
aatgtaagggttgaagctaagcttcattgtgacacagttagatatgaaccaggtggagga
ggaataaatgtttctcgggcagtaaaaaaacttggtggaagttccaggcttgtctatacc
tcaggtggttttacaggtagaaagctggataaacttctggagcaagaagaacttaattta
aagtccatagagattgaagattctatccgtgagaatttcataatatttgagcgggcctct
caacagcaatatagatttggtatgccaggcccaaaaataagtgatagtgaataccagatg
atatttgatatttttagtaatatagaaaattttcctgagtattttgttataagtggaagt
atcccggtgggtactgatgataaaatatatgcagaacttgctggacttgccaaaaaaaga
ggagcaaaggttatagttgatgtttccggtcctcctttaaaagcggtcatggaagaggga
gtttttttaattaaaccaaatatcggtgagtttcagcagttggttgggaaggaacttcag
gatgaagaagaaataaagaaatatgctcttaagtttgttaatgattcctgctgtgagatg
attgttatttccattggcgccggtggtgctctgcttgtttatcaagataaggctaagttt
atgcggccacctactgtacctattaaaagcaaggttggagctggtgacagtatggttgcc
ggaatggtcttaagtctttcacagggtaattcaattgaaaatgcttttgcttatggtata
gctgcaggctctgctgctgtgatgacacctggtacagagctgtgtcggaaagaagataca
gatagattgtataagagcatgatttaa

DBGET integrated database retrieval system