KEGG   Halanaerobium hydrogeniformans: Halsa_1586Help
Entry
Halsa_1586        CDS       T01349                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00230  Purine metabolism
has01100  Metabolic pathways
Module
has_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Halsa_1586
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Halsa_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 RsgA_GTPase AAA_17 AAA_16 Rad17 AAA_29 MMR_HSR1 NTPase_1 AAA_22 ABC_tran AAA_5
Motif
Other DBs
NCBI-ProteinID: ADQ15011
UniProt: E4RLU7
Position
complement(1767532..1768110)
Genome map
AA seq 192 aa AA seqDB search
MNKGILFVLSGPSGVGKNTVLDELFKEFDGVSYSVSATTREARNGEIEGEDYFFISEDKF
KEISADNGFIESALVHGHYYGTPKKFVDKKLSEGEDIILEIDTQGAKQVREKYPDAVYIF
LLPPSLEELEHRLDKRGSENNKAKNIRLENARKELKEVHNYDYEVINDSLSKAVSEIKKI
IIAEQKRRDQDD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagggattttatttgtattatccgggccatctggtgtgggaaaaaatacagtt
ttagatgaactttttaaagaatttgatggtgtttcttattcagtttctgccaccacccgg
gaagctaggaatggggaaattgaaggagaagattatttttttatatctgaagataaattc
aaagaaatttctgcagataatggttttatagaaagtgcattagttcacggccattattat
ggaacccctaaaaaatttgtagataaaaaattatctgaaggtgaagatattatattagaa
attgatacacagggagcaaaacaagtaagagaaaaatatcctgatgctgtctatattttt
ctgcttcccccatctttagaagaactagaacatcgcctggacaaaagaggttctgaaaac
aataaagctaaaaatatacgcttagaaaatgctcgtaaagagttaaaagaagttcataat
tatgattatgaagtaattaatgacagcttatctaaagcagttagtgaaattaaaaaaata
attatcgcagaacaaaaaaggagagatcaagatgattaa

DBGET integrated database retrieval system