KEGG   Halanaerobium hydrogeniformans: Halsa_1755Help
Entry
Halsa_1755        CDS       T01349                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halsa_1755
   01230 Biosynthesis of amino acids
    Halsa_1755
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_1755
  Energy metabolism
   00680 Methane metabolism
    Halsa_1755
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halsa_1755
Enzymes [BR:has01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Halsa_1755
Exosome [BR:has04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Halsa_1755
  Exosomal proteins of melanoma cells
   Halsa_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1956771..1957523)
Genome map
AA seq 250 aa AA seqDB search
MIIVKKIVFVRHGQSEWNLANKFTGWTDVDLSEQGIKEAEAAGEILEKEGFTFDLAFTSY
LKRATKTLNIILDIMDLHWIPVIKSWKLNERHYGDLQGLNKAEMTEKVGEEQVHIWRRSF
DTPPPALDADDSRHPKNESKYDELSEAELPDSESLKMTIKRVMPFWEKTIVPKIKEGRKI
IISAHGNSLRALVKHLDNISDEEISSLNIPTGRPLVYEFDEEMNVLDSYYLGDQEEIDAE
MQKVKDQAKS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgataattgtgaaaaaaattgtttttgttagacacggtcaaagtgaatggaatttagca
aacaaatttactggctggactgatgtagatttaagtgagcagggaataaaagaagcagaa
gcagcaggtgaaatattagaaaaagaaggatttacatttgatttagcattcacctcttat
ttaaaaagggcaacaaaaactttgaatattattttagatattatggatttacactggata
cctgttataaaatcttggaaattaaatgaaagacattacggtgatttacaaggtttaaac
aaggcagaaatgaccgaaaaggttggtgaagaacaggttcatatttggagaaggagtttt
gatactccaccacctgctttagatgctgatgattctcgccaccctaaaaatgagagtaaa
tacgatgaactttcagaagcagaacttccagattctgaaagcctaaaaatgacaattaaa
agagttatgcctttctgggaaaaaacaattgtacctaagattaaagaaggtagaaaaatt
atcatctcagcccatggtaatagtttaagggcacttgtaaagcatttagataatatctct
gatgaggaaattagttctttaaacattccaacaggtagaccacttgtttatgagtttgac
gaagaaatgaatgttttagatagttattatttaggagatcaagaagaaattgacgcagaa
atgcagaaagttaaagatcaagcaaaatcttga

DBGET integrated database retrieval system