KEGG   Halanaerobium hydrogeniformans: Halsa_1810Help
Entry
Halsa_1810        CDS       T01349                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00010  Glycolysis / Gluconeogenesis
has00350  Tyrosine metabolism
has00625  Chloroalkane and chloroalkene degradation
has00626  Naphthalene degradation
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
has01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_1810
  Lipid metabolism
   00071 Fatty acid degradation
    Halsa_1810
  Amino acid metabolism
   00350 Tyrosine metabolism
    Halsa_1810
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Halsa_1810
   00626 Naphthalene degradation
    Halsa_1810
Enzymes [BR:has01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Halsa_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 V_cholerae_RfbT ANTH
Motif
Other DBs
NCBI-ProteinID: ADQ15228
UniProt: E4RJ08
Position
complement(2014377..2015567)
Genome map
AA seq 396 aa AA seqDB search
MDLPNYYEFFNPIKINSGENSLNTLSYELEQLNVDKPLILTNQMLDEIKNLDILLESLAS
TDISPEQIIKNIPNQATVEIVKRCADKYNKYNCDGIIALGGEAIIDTAKGINLLISEKSK
SLKDLRGIDTIHSKMEPFIIIPTATGTGSEAALKAVITDDQFNKNLEFISNKLMPDLAVI
DPRMTYEMPPRLTASTGIDSLVHSIEAYTGLQRNPLSDAYAFSALKLIGSSLKPLVKNIS
NKYHRMAMNNAALMSGIAFANSRAGIIYAIGDACEKISGVSHGDALSIILPHGMFHNLKF
EYCRNSYQDILLALSGPEKYSNTPAKDRAVIAVAEIATLLNELQLLTGIPLTLSEIGVKR
NDFPDIIEKAMHNTAVLASAGKVKREDIESVLEAAF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggatttacccaattattacgagttttttaatccaatcaaaattaattccggtgaaaat
tcattaaatactttaagttatgagttagaacaactcaatgtggataagcctctgatctta
acaaatcagatgttagatgagattaaaaatttagatattttacttgaaagtttagcaagt
actgatatttctccagaacaaataataaagaatataccaaatcaggcaacagtagaaata
gtgaaaagatgtgctgataaatataacaaatataattgtgatggtattattgccctgggt
ggagaagcaataatagataccgctaaaggaataaatcttttaatatctgagaaaagtaaa
agccttaaagatctgaggggtatagataccatacattccaagatggagccttttattatt
attccaactgctacaggtacaggatcagaagctgctttaaaagctgttatcactgatgat
caatttaataaaaacctagaatttatatcaaataaattgatgcctgacctggctgtcatt
gatcccagaatgacctatgaaatgccgccacgacttactgcttcaacggggattgattca
ctggttcattcaattgaagcctacacgggattacagcgtaatcctttaagtgatgcttat
gctttttcggctttaaaattaattgggagttcacttaaaccactggttaaaaatataagt
aataaatatcacagaatggcaatgaataatgctgctttaatgtcagggatcgcatttgct
aattcaagagctggcattatatatgcaataggagatgcctgtgaaaaaatttctggagtt
tcacatggtgatgctttatcaattatattgccacatggaatgttccataaccttaaattt
gagtactgtcgcaattcatatcaggatattttgctggctctttctggcccagaaaaatat
tctaatactcctgcaaaagatagagcagtgattgcagttgctgagatagcaacactttta
aatgagctacaattattaacaggaatccccttaactttatctgaaataggagttaaaaga
aatgattttccagatattatagaaaaagccatgcataatactgctgttctagcatcagcc
ggtaaagttaaaagagaggatatagaaagtgttttagaagctgctttttaa

DBGET integrated database retrieval system