KEGG   Halanaerobium hydrogeniformans: Halsa_1817Help
Entry
Halsa_1817        CDS       T01349                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halsa_1817
   01230 Biosynthesis of amino acids
    Halsa_1817
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_1817
   00030 Pentose phosphate pathway
    Halsa_1817
   00051 Fructose and mannose metabolism
    Halsa_1817
   00052 Galactose metabolism
    Halsa_1817
  Energy metabolism
   00680 Methane metabolism
    Halsa_1817
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Halsa_1817
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Halsa_1817
Protein phosphatases and associated proteins [BR:has01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Halsa_1817
Messenger RNA biogenesis [BR:has03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Halsa_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2020809..2021807)
Genome map
AA seq 332 aa AA seqDB search
MNKIAILTSGGDAPGMNPAIRAVARTAIFYNIEVVGVRYGFKGLIEKDFFDMKRSSVADI
IQKGGTVLFSARCEEFRTREGREKAYQNMREEGIDALVVIGGDGSLHGVQKINQESEISA
VGIPATIDNDLSCTDYTIGVDTAMNTILDAINKIRDTATSHERTFVIECMGRDSGYLALM
TGLAGGAEFILVPEIDFTPQEVTNRIVQGFNKGKLHSLILIAEGVKAPFVDLTGYNGSPG
LAMGDLIREKTGMETRVTILGHLQRGGSPTAIDRIIASRMGAKAVDLLIEGHRDIMINYK
DNSIGSCKIADAIVEKQQIDMDIYNLSSILSM
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatagcaatattaacaagtggtggagatgctccaggaatgaaccctgctatt
agagcagttgctagaacagctattttttataacatcgaagtagtaggggtcagatatgga
tttaaaggtttaatagaaaaagatttttttgatatgaagagaagttcagttgcagatata
attcagaaaggaggaactgttcttttttctgctcgctgtgaagaatttagaacaagagaa
ggaagagaaaaagcctatcaaaatatgagagaagaaggaattgatgctcttgtagtaatt
ggtggagatggttctttacacggagtacaaaaaattaatcaagaaagtgagattagtgct
gtgggtattcctgcaactatagataatgacttatcatgtactgattatacaattggtgta
gatacagcaatgaatacaatacttgatgctataaataagataagagatactgctacttct
catgaaagaacatttgtgattgaatgtatgggaagagattcaggatatttagctttaatg
acaggtttagctggaggagcagaatttattttagtaccagaaattgacttcactcctcag
gaggtaacaaatagaatagtacagggatttaataaaggtaaattgcacagccttatttta
atagcggaaggtgtaaaagcaccttttgttgatctgaccggttataatggtagccctggt
cttgcaatgggagatttaattagagaaaaaactggcatggaaacaagagttactatatta
ggccatctgcaaagaggtggtagcccaactgcaattgatagaatcattgccagtcggatg
ggagcaaaagcagttgatctgttaattgaaggtcatagagatattatgataaattataaa
gataattccattggcagttgtaaaattgctgatgctattgtggaaaaacagcaaatagat
atggatatatataatttatctagtatattatccatgtaa

DBGET integrated database retrieval system