KEGG   Halanaerobium hydrogeniformans: Halsa_2113Help
Entry
Halsa_2113        CDS       T01349                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halsa_2113
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halsa_2113
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Halsa_2113
Enzymes [BR:has01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Halsa_2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2325742..2326989)
Genome map
AA seq 415 aa AA seqDB search
MKYVEGLHCIKCAKKYEADPERYLCDDCEDGILDVDYDYSKIKRDWSKEILKNTSDQRIW
RYTPLLPIEENTEKPKLAVGNTPIYDIQVLADELGIRKLIIKDDGLNPTASLKDRASAMA
VVKAQEAGAVTVACSSTGNAASSLAGNIASMGGRMKSVIFVPDRAPAGKLAQLLVYGADV
VSVKGTYEEAFYLSAAAIDKWGWYNRNAAINPYLVEGKKTVSIELAEQLNWQMPDWLVFS
VGDGCTIAGAYKGLYDLIQLGFIDKMPRLLGVQAEGCAPITEAFKSNEKLKVSKEDTIAD
SIAVGKPRNWIKAVRAVRDSEGDMINVSDQKILQMMKTLGEKSGVFAEPAGVAGLAGLKK
AVADGIVKKDQSAAVVITGNGLKDIKNARKAAGNPIEVEPDLDKLTEIFKKMGVI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatgttgaaggccttcattgcattaaatgtgctaaaaaatatgaggcagatcca
gaacgttatctctgtgatgattgtgaagatggtattttagatgttgattatgattattca
aaaataaaaagggattggtcaaaagagatattaaaaaatacttctgatcagagaatctgg
cgttatactccccttttacctatagaagaaaatactgaaaagccaaagttagctgttgga
aatactcctatttatgatattcaggttttagcagatgagttggggataagaaagttaata
attaaagatgatggtttaaatccaactgcatctttaaaagatcgggcttcagctatggcg
gtggttaaagcccaggaagcaggtgcagtgactgttgcctgttcttcaacagggaatgca
gcttcttcattggcaggcaatattgcctcaatggggggaagaatgaagtcggttattttt
gtccctgatagagctccagctgggaaattagcccagctattagtttatggagcagatgtt
gtttctgttaaaggtacatatgaagaagctttttatctatcggcagcagctattgataaa
tggggctggtataatcgtaatgcggcaattaatccttatcttgttgagggcaaaaaaact
gtttctatagagctggctgaacaactgaactggcagatgccagactggttggttttttcg
gttggagatggttgtacaattgctggagcatataaagggctatatgatttaatccagctg
ggatttattgataaaatgccaagattacttggtgtgcaggcagaaggttgtgccccaata
actgaggcatttaaaagtaatgagaagctgaaagttagtaaagaagatactatagctgac
agtatagcagttggtaaaccccggaactggattaaagcagttagagcagtcagagattct
gagggagatatgataaatgttagtgatcaaaaaatactgcagatgatgaaaactctgggt
gaaaaaagtggtgtttttgctgaaccagccggtgtagcaggattagcaggtttaaaaaaa
gcagtggcagatggaattgtaaaaaaagatcaaagtgctgcagttgtaataaccggtaat
ggacttaaagatatcaaaaatgctagaaaggcagctggaaacccgattgaagtcgaacct
gatttagataaattaactgagatatttaagaaaatgggtgtgatatga

DBGET integrated database retrieval system