KEGG   Halanaerobium hydrogeniformans: Halsa_2153Help
Entry
Halsa_2153        CDS       T01349                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halsa_2153
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halsa_2153
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halsa_2153
Enzymes [BR:has01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halsa_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2366098..2366889)
Genome map
AA seq 263 aa AA seqDB search
MSKITAQFKNKKALITYISGGDPSLEMTEKLIYRLQDEGVDIIEIGIPFSDPLADGPVIQ
EASQRALKNGCTLKKLIEMLTDIKDKVKVPLVLMGYYNSVLNYGEKEFVEAIKKAGVSGV
IIPDLPVDEKAKLSYYLKEADLDQILLVTPNTSDERLKEISSLSSGFLYCVALLGTTGDA
RGPYPKLESYLKRVRKTAGDIPLGLGFGIDGPEKVKKIVDYPDGIIIGSALIKAITAGQT
EKEKLENAGEFVRNIKKVLANYK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaataacagctcaatttaaaaacaaaaaagcgttaataacctatattagtgga
ggagatcccagtctggaaatgaccgaaaaattaatctatcgccttcaggatgagggggtt
gatattatagagatcgggatcccattttctgatccacttgcagatggccctgttattcag
gaggcttcacagcgtgctttaaaaaatggatgtactctaaaaaagttaattgagatgctg
acagacattaaagataaagttaaggttccgctggttttaatgggttattataattcggtt
ttaaattatggggaaaaagaatttgtagaagctattaaaaaagcaggagtttccggagtt
attattccggatttgccggttgatgaaaaagctaaattatcatattatttaaaagaggcg
gatttagatcagattttgcttgttactcctaatacatcagatgagcgtttaaaagaaata
agtagtttaagctctggttttctttattgtgttgctttattgggaactaccggtgatgct
agaggtccatatccaaaattagaaagttatttaaaaagagttcgaaaaacagcaggagat
atcccccttggactgggctttggaatcgatggtccagaaaaagttaaaaagattgttgat
tatccggatgggattatcatcggcagtgccttaataaaagctattacagccggacaaaca
gaaaaagaaaaactggagaatgcaggagaattcgtaagaaatataaaaaaagttttagct
aattataaataa

DBGET integrated database retrieval system