KEGG   Halanaerobium hydrogeniformans: Halsa_2154Help
Entry
Halsa_2154        CDS       T01349                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halsa_2154
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halsa_2154
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halsa_2154
Enzymes [BR:has01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halsa_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2366882..2368105)
Genome map
AA seq 407 aa AA seqDB search
MRNQAKKLRVKNDLNKGYFSEFGGRFVPETLIPVLDELEEVYNHYKNDPAFKKQLKSLLA
DYSGRPTALYYAEQLSKYYGGAKIYLKREDLNHTGAHKINNTLGQILLAVKMGKKRIIAE
TGAGQHGVATATVAARFNLDCEIYMGAEDMERQALNVYKMEMLGAKVTEVNSGTQTLKDA
TNEAIRDWVRNVEDTHYIIGSVVGPHPYPMMVRDFQRIIGDECKKQIKAKEGCLPDYILA
CVGGGSNAMGIFYPFINDKEVKMIGIEASGKGIESGKHAATLSAGRVGVLHGSKSFLLQD
EDGQIIPAYSISAGLDYPGVGPEHSYLKTIERVEYHSATDIEAIKAFKLLSEKEGIIPAL
ESSHALSYLEKLAPQLSKEKIIVVNLSGRGDKDINNFKKVKEAEENV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcaggcaaaaaaattgagagtaaaaaatgatttaaataaaggttatttttct
gaatttggaggtcgttttgttccagaaaccttgataccggttctagatgaattagaagag
gtttataatcactataaaaatgatcctgcttttaaaaaacaattaaaatcactcttagca
gattatagtggaagacccaccgctttatattatgctgaacaattgagcaaatattatggg
ggagctaaaatatacctaaaaagagaggatctaaatcacaccggtgctcataaaataaat
aatactttaggtcagatattactggcagttaaaatgggtaaaaaaaggattattgctgag
actggtgctggacagcatggtgtagctactgctaccgttgcagctcgatttaatttagat
tgtgaaatttacatgggggcagaagatatggaaagacaggctcttaatgtatataagatg
gaaatgttaggagctaaggtcactgaagttaattcagggactcaaacccttaaagatgca
acaaatgaagctatcagggattgggtgcgtaatgttgaagatacccactatattatcggt
tctgtagttgggccccatccttatccaatgatggttagagattttcaaagaataattggt
gatgaatgcaaaaaacaaatcaaagccaaagaaggttgtcttcctgattatattttagcc
tgtgttgggggcggaagtaatgcgatgggtatattttatccttttataaatgataaagaa
gttaagatgatcgggattgaagcctctggtaaaggaattgaaagtggaaaacatgcagca
actctttctgctggaagggttggggttttacatggcagtaaatcatttttgcttcaagat
gaagatggacagataattccagcttattctatttctgcaggtctggattatcctggggtt
ggacctgaacatagttatttaaaaacaattgaaagggtagaatatcattctgccactgat
attgaggctattaaagcttttaaactattatcagaaaaagaggggattattccagctctt
gaaagctcacatgccttatcttatctggaaaaattagctcctcagctatctaaggagaag
attatagttgttaatctctcgggtcggggagataaagatatcaataatttcaaaaaggtt
aaggaggcagaagaaaatgtctaa

DBGET integrated database retrieval system