KEGG   Halanaerobium hydrogeniformans: Halsa_2208Help
Entry
Halsa_2208        CDS       T01349                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2424809..2425432)
Genome map
AA seq 207 aa AA seqDB search
MKIVATKMLLIRHGETDWNKELIFQGHSDTELNEKGIKNAKKNAELLKDLNYDYIYCSDL
KRAKDTAGFIADKLNKKIIESKEIRELDFGKWEGLDFKSIEEKYPDEFKAWQEDFLKNNP
PGGEKISDFTERVNRFFKSVLKKHRDKKIIVVTHGGVIKTYLTEIMAVPKKRFWQFQIEN
NSLTEIKFTGEVAVLTKLNLLYSNNFK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatagtggcaacaaaaatgcttttaattagacatggagaaacagattggaacaaa
gaattgatttttcaagggcatagcgatacagaattaaacgaaaaaggtataaaaaatgct
aagaaaaatgcagaattgttaaaagatctcaactatgattatatttattgtagtgatcta
aaaagggcaaaagatacagctggttttatcgcagataagctgaataaaaaaataattgaa
agtaaagaaatccgcgaattagattttggtaaatgggaaggacttgactttaaatcaata
gaagagaaatatcctgatgaatttaaggcctggcaagaagattttttaaaaaataatcct
cctggaggagaaaagataagtgattttactgagagagtaaatcgcttttttaaaagtgtt
ttaaaaaaacacagggataaaaaaattattgtagtaacccatggtggagttattaaaact
tatttaacagaaataatggcagtaccaaaaaagagattctggcagtttcagattgagaat
aattctctgacagaaattaaatttactggagaagtagctgttttgacaaagctaaatctt
ttatactctaataattttaagtga

DBGET integrated database retrieval system