KEGG   Halanaerobium hydrogeniformans: Halsa_2208Help
Entry
Halsa_2208        CDS       T01349                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
has  Halanaerobium hydrogeniformans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halsa_2208
   01230 Biosynthesis of amino acids
    Halsa_2208
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_2208
  Energy metabolism
   00680 Methane metabolism
    Halsa_2208
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halsa_2208
Enzymes [BR:has01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Halsa_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2424809..2425432)
Genome map
AA seq 207 aa AA seqDB search
MKIVATKMLLIRHGETDWNKELIFQGHSDTELNEKGIKNAKKNAELLKDLNYDYIYCSDL
KRAKDTAGFIADKLNKKIIESKEIRELDFGKWEGLDFKSIEEKYPDEFKAWQEDFLKNNP
PGGEKISDFTERVNRFFKSVLKKHRDKKIIVVTHGGVIKTYLTEIMAVPKKRFWQFQIEN
NSLTEIKFTGEVAVLTKLNLLYSNNFK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatagtggcaacaaaaatgcttttaattagacatggagaaacagattggaacaaa
gaattgatttttcaagggcatagcgatacagaattaaacgaaaaaggtataaaaaatgct
aagaaaaatgcagaattgttaaaagatctcaactatgattatatttattgtagtgatcta
aaaagggcaaaagatacagctggttttatcgcagataagctgaataaaaaaataattgaa
agtaaagaaatccgcgaattagattttggtaaatgggaaggacttgactttaaatcaata
gaagagaaatatcctgatgaatttaaggcctggcaagaagattttttaaaaaataatcct
cctggaggagaaaagataagtgattttactgagagagtaaatcgcttttttaaaagtgtt
ttaaaaaaacacagggataaaaaaattattgtagtaacccatggtggagttattaaaact
tatttaacagaaataatggcagtaccaaaaaagagattctggcagtttcagattgagaat
aattctctgacagaaattaaatttactggagaagtagctgttttgacaaagctaaatctt
ttatactctaataattttaagtga

DBGET integrated database retrieval system