KEGG   Halanaerobium hydrogeniformans: Halsa_2295Help
Entry
Halsa_2295        CDS       T01349                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00010  Glycolysis / Gluconeogenesis
has00020  Citrate cycle (TCA cycle)
has00620  Pyruvate metabolism
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
has01200  Carbon metabolism
Module
has_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_2295
   00020 Citrate cycle (TCA cycle)
    Halsa_2295
   00620 Pyruvate metabolism
    Halsa_2295
Enzymes [BR:has01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Halsa_2295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Tae4
Motif
Other DBs
NCBI-ProteinID: ADQ15703
UniProt: E4RKW2
Position
complement(2517039..2518313)
Genome map
AA seq 424 aa AA seqDB search
MASELIMPKLSMTMEEGQIVNWLKDEGEEVEAGEVILEVLSDKTNFEIESPDNGILLKKL
YQEDDVVPVTEVIAYIGEEDEDIDELIDKTEEDSAAEIEEVEEESSDKAEEKEEVKIESD
VEISTESEEIVVDKIKTVPAVRRIARENNIDLNLVKASSEDNVIRVKDIREYMDSKAAKE
KEKEAELKSVKEPSSEETIIDKLTGIRKASAKKVKESWTEIPHVTITNEVNMEKLLELKD
DWNKHQGDDKLKVSVTDILIKIVATVMEKHKVLNAYLEEEKIVYNDNINIGLAVSLGDKL
TAPVLKDLKNQKIQNIVKEKQQLIEKAKNNKLSSEDLSGARLTITNLGMYGTEIFTPIIN
APASSILGVGKIKKKPVVVDDEIVIQRMMWLSLAFDHRLVEGAPAANFLNEIKELIEFPA
KVMF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagaattaataatgccaaaactaagtatgacaatggaagaaggccagattgta
aactggttaaaagatgaaggggaagaggtcgaagcaggtgaagttattttagaagtttta
agtgataagaccaactttgaaattgaatcacctgataatggaattctattaaaaaaatta
tatcaagaagacgatgttgtaccagttacagaagtaattgcttatattggtgaggaagat
gaagacatagatgagttaatagataaaactgaggaagatagtgcagcagaaatagaggaa
gttgaagaagagtcttctgataaagctgaagaaaaagaagaagttaaaatagaaagtgat
gtagaaatctctacagaaagcgaagaaattgttgtagataaaataaaaacagttccagca
gtaaggagaattgcaagagaaaataatatcgacttgaatctagtaaaggctagttcggaa
gataatgtgattagggttaaagatattagagagtatatggattcaaaagcagcaaaagaa
aaagaaaaagaagcagaacttaagtcagtaaaagagccaagttcagaagaaactattatt
gataaattaactggaattcgcaaggctagtgcaaaaaaagttaaagaaagctggactgag
ataccacatgttacaataactaatgaagttaatatggaaaaattacttgaattaaaagat
gactggaacaaacatcagggtgatgataaactaaaagtttcagttactgatatactgatt
aaaattgtagcaaccgttatggaaaagcacaaagttttaaatgcctatttagaagaggaa
aaaatagtttataatgataatatcaatataggcttagctgtatctttgggagataaactt
actgcaccagtacttaaagatttaaaaaaccagaaaatccagaatattgttaaagaaaag
cagcaattaatagaaaaagccaaaaataataaattgagttctgaagatttaagtggagca
agacttactataacaaatttagggatgtatggaactgaaatatttacaccgatcataaat
gctccagcaagcagtattttgggagtaggaaaaatcaagaaaaagccagtagtagtagat
gatgaaatagtaattcaaaggatgatgtggcttagtcttgcttttgatcaccgacttgtt
gaaggagcaccagcagctaactttttaaatgaaatcaaagaattaatagaattcccggca
aaagttatgttttaa

DBGET integrated database retrieval system