KEGG   Herpetosiphon aurantiacus: Haur_0131Help
Entry
Haur_0131         CDS       T00614                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Haur_0131
Enzymes [BR:hau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Haur_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
162124..162744
Genome map
AA seq 206 aa AA seqDB search
MTLIYSGNGLNGNSAPAVREDMEAAVRTILEGLGEDVDREGLQRTPHRVAKMFGELTAGY
HTDPVALINDAIFTVEYNEMVLVRDIEFSSLCEHHMLPFWGKAHVAYVPNGKVLGLSKIP
RIVDMFAKRLQVQERLTREIADFVAQTIDASGVAVVVQGAHMCSMIRGVKKANARMVTQS
LQGVFKTDPQIRAEFMGHITANFSDD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttatttactctggcaatggactcaatggcaactcagcaccagcagtgcgcgaa
gatatggaagccgccgtgcgaaccattctcgaaggtctcggcgaggatgttgatcgtgag
ggcttgcaacgcaccccgcatcgggttgccaaaatgtttggcgagctgaccgctggttat
catactgatccggtggcgttgattaacgatgccatttttacggtcgaatataacgaaatg
gtcttggtgcgtgatattgaattttcgtcgctgtgcgaacatcatatgttgccattttgg
ggcaaagcccacgttgcctatgtgccaaatggcaaagtgcttgggctttcgaaaattcca
cggattgttgatatgtttgccaaacgtttgcaagtgcaagaacgcctaacccgcgaaatc
gccgattttgtggcgcaaacgatcgatgcaagcggcgtagcagtggtggtacagggtgcg
catatgtgctcaatgattcgtggcgttaaaaaggccaacgctcgcatggtcacgcaatcg
ttgcaaggtgtgtttaaaaccgatccgcaaattcgcgctgaatttatgggtcatatcacg
gcgaatttttccgatgactaa

DBGET integrated database retrieval system