KEGG   Herpetosiphon aurantiacus: Haur_0222Help
Entry
Haur_0222         CDS       T00614                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Haur_0222
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Haur_0222
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Haur_0222
Enzymes [BR:hau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Haur_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(258893..260092)
Genome map
AA seq 399 aa AA seqDB search
MTDHAVLDELNGRYGDFGGRYVPETLMAAIEELTEAFFRIRTDPEFQAELQHLHQTYTGR
PTALTYARRLTEELGGAQIWLKREDLTHTGAHKINNALGQGLLAKRMGKQRIIAETGAGQ
HGVATAAVCALLGLQCVVYMGTEDMERQKPNVFRMRLLGADVRGVSTGSKTLKDAVNEAM
RDWVSNPDSYYLLGSALGPHPYPLMVREFQSIIGIEAREQILAATGKLPNTIIACVGGGS
NAIGMFHAFINDEHVDLRGVEAGGHGIELGRHAARFAGGRLGVFQGTRSYVLQNSDGQIA
NTHSISAGLDYAAVGPEHAWLHDEERAFYTYATDEEALNGFQMLCRTEGIIPALESSHAI
AEAVRLAPTMSKESIILVNLSGRGDKDIFTVADVLGVQM
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacgctgttcttgatgaattaaatggccgctatggggatttcggtggacgc
tatgtgccagaaaccttgatggccgcgatcgaagaattaaccgaagccttttttcggatt
cgcaccgaccctgagtttcaggctgaactccaacatttgcaccagacctatacgggccga
ccaactgccctcacctatgcccgccgcttgaccgaggaattgggtggtgctcaaatttgg
ctcaaacgcgaagacctgacccacactggcgcacataaaatcaataatgccttagggcaa
ggcttgttggccaaacgcatgggcaaacagcggatcatcgctgaaactggcgctggccag
catggcgttgctaccgctgccgtttgtgccctgcttgggctgcaatgtgtggtctatatg
ggcaccgaagatatggagcgccaaaagcccaatgtctttcgtatgcgcttgctgggagcc
gatgtgcgtggagtcagcactggctcgaaaaccctcaaagatgcagttaacgaagccatg
cgcgattgggtcagcaaccccgattcgtactatttgcttggctcggcgcttggcccacac
ccttatccattgatggtacgcgaatttcaaagcatcatcggaattgaagcccgcgagcaa
attttagcagcaactggcaaattgcccaacacgattattgcttgcgttgggggtggctcg
aacgcaatcgggatgttccacgcctttatcaacgatgaacatgttgatttgcgaggagtt
gaagctggtggtcatggaattgagcttggtcgccatgcagcgcggtttgcaggcgggcgc
ttgggcgttttccaaggcacccgttcgtatgtgctgcaaaatagcgatggccaaattgcc
aatacccatagcatttctgctggtctcgattatgctgctgtaggcccagagcacgcttgg
ctccacgacgaggaacgggctttctatacctatgccaccgacgaagaggccttgaatggt
tttcaaatgctctgtcgaactgaaggcattatcccagccttagaatcgtcgcatgcgatt
gccgaagctgtacgtttagccccaaccatgagcaaagaaagcattattttggtcaatctg
tcggggcgtggcgataaagatattttcaccgttgcagatgtattgggagtgcaaatgtag

DBGET integrated database retrieval system