KEGG   Herpetosiphon aurantiacus: Haur_0222Help
Entry
Haur_0222         CDS       T00614                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00260  Glycine, serine and threonine metabolism
hau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
hau01130  Biosynthesis of antibiotics
hau01230  Biosynthesis of amino acids
Module
hau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Haur_0222
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Haur_0222
Enzymes [BR:hau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Haur_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX02874
JGI: Haur0222
UniProt: A9B6H1
Position
complement(258893..260092)
Genome map
AA seq 399 aa AA seqDB search
MTDHAVLDELNGRYGDFGGRYVPETLMAAIEELTEAFFRIRTDPEFQAELQHLHQTYTGR
PTALTYARRLTEELGGAQIWLKREDLTHTGAHKINNALGQGLLAKRMGKQRIIAETGAGQ
HGVATAAVCALLGLQCVVYMGTEDMERQKPNVFRMRLLGADVRGVSTGSKTLKDAVNEAM
RDWVSNPDSYYLLGSALGPHPYPLMVREFQSIIGIEAREQILAATGKLPNTIIACVGGGS
NAIGMFHAFINDEHVDLRGVEAGGHGIELGRHAARFAGGRLGVFQGTRSYVLQNSDGQIA
NTHSISAGLDYAAVGPEHAWLHDEERAFYTYATDEEALNGFQMLCRTEGIIPALESSHAI
AEAVRLAPTMSKESIILVNLSGRGDKDIFTVADVLGVQM
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacgctgttcttgatgaattaaatggccgctatggggatttcggtggacgc
tatgtgccagaaaccttgatggccgcgatcgaagaattaaccgaagccttttttcggatt
cgcaccgaccctgagtttcaggctgaactccaacatttgcaccagacctatacgggccga
ccaactgccctcacctatgcccgccgcttgaccgaggaattgggtggtgctcaaatttgg
ctcaaacgcgaagacctgacccacactggcgcacataaaatcaataatgccttagggcaa
ggcttgttggccaaacgcatgggcaaacagcggatcatcgctgaaactggcgctggccag
catggcgttgctaccgctgccgtttgtgccctgcttgggctgcaatgtgtggtctatatg
ggcaccgaagatatggagcgccaaaagcccaatgtctttcgtatgcgcttgctgggagcc
gatgtgcgtggagtcagcactggctcgaaaaccctcaaagatgcagttaacgaagccatg
cgcgattgggtcagcaaccccgattcgtactatttgcttggctcggcgcttggcccacac
ccttatccattgatggtacgcgaatttcaaagcatcatcggaattgaagcccgcgagcaa
attttagcagcaactggcaaattgcccaacacgattattgcttgcgttgggggtggctcg
aacgcaatcgggatgttccacgcctttatcaacgatgaacatgttgatttgcgaggagtt
gaagctggtggtcatggaattgagcttggtcgccatgcagcgcggtttgcaggcgggcgc
ttgggcgttttccaaggcacccgttcgtatgtgctgcaaaatagcgatggccaaattgcc
aatacccatagcatttctgctggtctcgattatgctgctgtaggcccagagcacgcttgg
ctccacgacgaggaacgggctttctatacctatgccaccgacgaagaggccttgaatggt
tttcaaatgctctgtcgaactgaaggcattatcccagccttagaatcgtcgcatgcgatt
gccgaagctgtacgtttagccccaaccatgagcaaagaaagcattattttggtcaatctg
tcggggcgtggcgataaagatattttcaccgttgcagatgtattgggagtgcaaatgtag

DBGET integrated database retrieval system