KEGG   Herpetosiphon aurantiacus: Haur_0301Help
Entry
Haur_0301         CDS       T00614                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Haur_0301
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Haur_0301
Enzymes [BR:hau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Haur_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
359280..361604
Genome map
AA seq 774 aa AA seqDB search
MTEQRHHSSIPLAAWQRPLGLDYPNAAIAAHDHGPIIDDGVFHGLPIGGMGSGAIGRNFR
GDWSRWHLEVGKHVHRSVWPNQWSVFWQTASQQAAQVLCTTQPDTDELSSWNWNYPVGAG
NYHALFPRAWFDYQHPDWPLELVQEQFSPVLAGNLKESSFPVGVFTWRVTNRGSETVRLG
LMLTWEHTRAVEAAGLSLQRQHSAWNDGNTSGVTLTQTSDQALSSHNGTWALAVQAPESA
SVSQWTCWDVAQDAAALWQDFASDGQLADYPTSQKVAADQRSATAIAVTLELAPGASAVI
PFSLAWDFPIVEFADQSRWYKRYTRFWGTNGDQAQALAVASLTNADAWRTAIEAWQNPIL
ADDQRPFWYKSALFNELYYLVDGGTLWVDRAVGGPEPAADDVGLFSYLECYDYPFYGTLD
VSFYSSWSILALWPELERGEILAFSKTVNDADDTVVTIVATQVPAIRKAAGALPHDLGAP
KEQPLIKTNAYDFQDINNWKDLNLKYILRIYRDVSLWNDQAMLEATWDTIPTALEYVHQF
DSDGDGLLDHSGADQTYDTWAMSGAASYSASLLICALEAAIRLAQRMGDHAQADAWSEWL
AAARQSFETKLWNGTYFRYHTADTDLREVIMADQLVGQWYAGAIGLPAVAPREMIRSALQ
TVYRFNVMQYANGALGAVNGMHPDGTVDTSSNQASEVWSGTTYAIAAMMLQEGLDLEGWQ
TAWGAYNATYNELGLWFRTPEAWGIERTFRASMYMRPQSIWAIEHALAVRAKNA
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaacgccaccattcctcaattcctctcgctgcgtggcaacgcccacttggc
ctcgattatccgaatgcggcgattgccgcccacgatcatgggccgattattgacgatgga
gtctttcatggtttgccaattggtggcatgggtagcggggcgattggccgcaactttcgc
ggcgattggtcacgctggcatttagaggttggcaagcacgtacatcgcagcgtttggccg
aatcaatggagtgttttctggcaaaccgccagtcaacaagccgcccaagttttatgcacg
acccaaccagataccgatgaattgagtagctggaactggaattatccagttggcgctggc
aattatcatgcacttttcccccgcgcttggttcgattatcaacaccccgattggccactg
gaattggttcaagagcaattttcgcctgttttggcgggtaatctcaaggaaagcagcttt
cccgttggcgtgtttacctggcgcgtaaccaatcgtggcagcgaaaccgtgcgtttggga
ttgatgctgacatgggaacatacccgtgcggtcgaagctgctggcttaagcttgcaacgc
caacacagcgcttggaacgacggtaacaccagcggcgtaaccttgacccaaaccagcgat
caagccttgagcagccataatggcacttgggctttggcggtgcaagcccccgaatcggcc
agcgtcagtcaatggacatgctgggatgttgcgcaagatgctgccgcgctctggcaagat
tttgccagtgacggccaattagccgactatccaaccagccaaaaagttgctgccgatcaa
cgcagcgcaacggcaattgccgtcaccctcgaattagcgcctggtgctagcgccgtgatt
cccttcagcctcgcttgggattttccaattgtcgagtttgctgatcaaagccgctggtac
aagcgctatacccgtttttggggcacgaacggcgatcaagctcaagccttggcggttgct
agtttgaccaatgctgatgcttggcgtacagcaattgaagcatggcaaaaccccattctt
gctgatgatcaacggccattttggtataaatctgctctttttaacgaactctattatttg
gttgatggtggtacgttgtgggttgatcgggcggttggcgggccggagcctgcggctgat
gatgtgggcttgttcagctacctcgaatgctacgactacccgttctatggcacgctcgat
gtgtcgttctacagctcgtggagcatcttggccttgtggccagagcttgaacgcggcgag
attttggccttctccaaaacggttaacgatgctgatgataccgttgtcacaattgtggca
actcaagtcccagcaattcgcaaggccgctggcgcattgccgcatgatcttggtgcgccc
aaagagcaaccattaatcaaaaccaatgcctacgacttccaagatatcaataactggaaa
gatctcaacctcaagtatattttgcgaatctatcgtgatgtgagcttgtggaacgatcag
gccatgctggaagcaacttgggacacaattccaactgctttagaatatgtgcatcaattc
gatagtgatggcgatggcttgctcgaccatagtggagccgaccaaacctacgatacctgg
gccatgagcggcgcggccagctattcggcaagcttgctgatttgtgccttggaagctgcg
attcgcctagcccaacgcatgggcgaccatgcccaagccgatgcttggagtgaatggctg
gccgcggctcgccaaagttttgaaactaagctttggaatggtacttacttccgctatcac
accgctgatactgatttgcgcgaagtgattatggccgatcaattggtgggccaatggtat
gcaggcgcaattggcttgccagcggttgctccacgcgagatgattcgctcggccttgcaa
acggtctatcgcttcaacgtcatgcaatatgccaacggcgcattgggtgcagtcaacggc
atgcatccagatggcacggttgataccagctccaaccaagccagcgaagtttggagcggc
acgacctatgcgattgcggccatgatgctgcaagaagggcttgatcttgaaggctggcaa
accgcttggggagcctataacgccacctataatgaacttggattgtggtttcgcacaccg
gaagcatggggcatcgaacgaactttccgtgccagcatgtacatgcgaccacaatcaatc
tgggcgattgagcatgccttagcggtgcgtgctaaaaacgcctga

DBGET integrated database retrieval system