KEGG   Herpetosiphon aurantiacus: Haur_0619Help
Entry
Haur_0619         CDS       T00614                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Haur_0619 (gmk)
Enzymes [BR:hau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Haur_0619 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
715409..716041
Genome map
AA seq 210 aa AA seqDB search
MSHPELNPILHNQAPVPLLVIISGPSGVGKDTVLMRMREFGMPFHFVVTTTSRGQRPGEL
EGFDYNFVSKAEFETMIAQNDLLEHAVVYGEYKGIPKSQVRDALASGKDVILRIDVQGAA
TMRKLVPDAVLIFIVPPSSAELANRLRLRRTESAEGLERRMALAEEEMGRVDEFDYVVMN
PESRPDEAASMIQAIIRAEKSRIRPRRIKL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacacccagaactcaacccgattttgcacaaccaagctcctgtgccattactggtc
attatttcaggcccatcaggggttggcaaagatacggtgttgatgcgaatgcgcgaattt
ggcatgccctttcattttgtggtcaccactaccagccgtggccaacgcccaggtgaatta
gagggctttgattataattttgtttccaaagccgagtttgagaccatgatcgcccaaaac
gaccttttggagcatgcggtcgtttatggcgaatacaagggcattcccaaatcgcaggta
cgcgatgccttggcgagcggcaaagatgtaattttgcggatcgatgtgcagggcgcggcc
accatgcgcaaattagtgcccgatgcggtgttgattttcatcgtgccaccttcaagcgcc
gaattggccaaccgcttacgcctacgccgcaccgaatcagcagagggcttagaacggcgc
atggccttggccgaagaagaaatgggtcgcgtcgatgaatttgattatgtggtgatgaac
cccgaatcgcggcctgacgaagccgccagcatgattcaagcgatcattcgcgccgaaaaa
tcacgcatccgcccccgccgcattaaactgtag

DBGET integrated database retrieval system