KEGG   Herpetosiphon aurantiacus: Haur_0798Help
Entry
Haur_0798         CDS       T00614                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hau00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(901716..903206)
Genome map
AA seq 496 aa AA seqDB search
MQYIAALDQGTTSTRCMVFDHNGNVVGVDQREHTQIFPQPGWVEHNPAEIWQRTQGVIAG
ALAAANIEKSDLAALGITNQRETTVIWDRHTGKAIYNALVWQDTRTDALVRQFAADGGQD
RFRAQTGLPLATYFSATKIRWLLDQVEGAQAAAEAGDLLFGTIDCFVAWWLTGGPHGGLH
ITDTTNASRTLLLNLTTGDWDAELLEIFRIPRSMLPNVRSSSEVYGTCRGQLDGVPLAGI
LGDQQAATVGQVCFEVGEAKNTYGTGNFMLLNTGERLVQSRHGLITTPAYHFGKQPTWAL
EGSIAVTGSLVQWLRDNLGIIHSAAEVEPLAASVADNGGVYLVPAFSGLFAPHWRSDARG
VLVGLTRYANKAHIARAALEATAYQTREVVSAMAQDSGVELTALKVDGGMVANELLMQFQ
ADILGVPVVRPKVAETTALGAAYAAGLAVGYWANPAELRANWSESKRWEPQMSSDQRDSL
YAQWNKAVQRTLNWQE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatattgcggcactcgaccaaggtacaaccagcacgcgctgtatggttttcgac
cataatggcaatgttgtcggcgttgatcaacgtgagcatacccagattttcccgcagcca
ggctgggtcgagcataatcccgccgagatttggcaacgaacccagggcgtgatcgcagga
gcactagcggctgccaacatcgaaaaaagcgatctggcggcgctgggcattaccaatcag
cgtgaaacaaccgtcatttgggatcgccacaccggcaaggcaatctacaatgctttagtt
tggcaagatacccgcactgatgcgctggtgcgccaatttgctgctgacggtggacaagat
cgttttcgggcgcaaactggattgcccttggcgacctatttttcagccaccaaaattcgt
tggctgcttgatcaggttgagggtgcgcaagcagcggctgaagcaggcgatttgttgttt
ggcacgatcgattgttttgttgcttggtggttgacgggtggcccccatggtggattgcac
atcaccgacacaacgaatgcctcacgtaccttgctgctcaacctcacgactggcgattgg
gatgctgaattattggagatttttcgcattccgcgcagcatgttgccaaatgtgcgctcc
tcaagcgaggtgtatgggacatgtcgcggccaactcgatggcgtgccattagcaggaatt
ttgggtgatcaacaagctgcaacggttgggcaagtatgctttgaagttggcgaggccaaa
aatacctatggcactggcaattttatgctgctcaatactggtgagcgcttggtgcaatcg
cgccatggcttaattaccacgccagcctatcattttggcaagcagccaacgtgggcctta
gaaggctcaatcgcagtaactggctcgttggtgcaatggctacgcgacaatttggggatt
atccacagtgcggctgaggtcgaaccgttggctgccagcgtagccgataacggtggcgta
tatctggtgccagccttttcgggcttgtttgccccgcattggcgctccgatgcgcgaggc
gtgttggttgggctaacgcgctatgccaataaagctcatatcgcgcgagcggcgcttgaa
gccactgcctaccaaacccgcgaagtcgtcagcgccatggcccaagattcaggggttgag
ttgacggcgctcaaagttgatggcggaatggtggcgaatgaattgcttatgcagtttcag
gctgatattttgggtgtaccagttgtgcggcccaaagttgccgaaaccaccgccttgggg
gctgcctacgccgctggtttggctgttggctactgggcgaatccagctgaattacgcgcc
aactggagcgaaagcaagcgttgggagccgcaaatgagcagcgatcagcgtgatagcttg
tatgcacaatggaacaaagcagtgcaacgcacgctcaattggcaagaataa

DBGET integrated database retrieval system