KEGG   Herpetosiphon aurantiacus: Haur_0837Help
Entry
Haur_0837         CDS       T00614                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hau00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hau00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
947328..948614
Genome map
AA seq 428 aa AA seqDB search
METFVIEGGHRLNGTITPAGNKNAALPLLAACLLSDQPIILRNMPDIADVRVKVQLLQSL
GIECSWLEENVLRVHAATINTSEPDTALARRIRTSILLAGPLLVRTGRAVLARPGGDSIG
HRRLDTHFLALTALGAEVEVTKQAYELKADGLVGTDIFLDEMSVTGTEQAIMAAVLASGT
TTIVNAASEPHVQDLCRCLFAMGAKITGIGTNSLQIQGVSRLNGTEYTLGPDFMEVGSFI
GLAAVTGSNIRIANARPEEHRMTRIMFGRLGVTWQDEGPDIVIPAEQELRVRDDLHGVVP
KIDDMPWPGFPPDLMSIALVIATQAQGTVLIHEKMFDGRLFFVDKLLSMGARVILCDPHR
AVVVGPAKLYGERLTSPDIRAGMALVIAALCAKGTSIISNIAQIDRGYQRIEQRLAALGA
RIERRPAE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacctttgtcattgagggcggtcatcgcctgaatgggacgattacgcctgccgga
aacaaaaacgccgccttgccgttgttagcggcctgcttgctcagcgaccaaccaattatt
ctgcgcaatatgcccgatattgccgatgtgcgagtcaaggtacagttattgcagtcattg
ggcatcgaatgtagctggctcgaagagaatgtgctgcgggttcatgctgccacgatcaat
acctcagagccagatactgcgcttgcgcggcgaattcggacctcgattttgctcgcaggg
ccgttgttggtgcgcactgggcgggcagttttagcgcggccaggcggcgattcgattggc
catcggcgtttggatacgcactttttggccctcactgccttgggtgctgaagttgaagtg
accaaacaagcctatgaactcaaagccgatggtttggttggcacggatattttccttgat
gaaatgagcgtaactgggactgaacaggcgatcatggcggctgtgttggcttctggcacg
accacaattgtcaacgccgcttctgagccacatgtccaagatctgtgtcgttgtttattt
gccatgggcgctaaaatcacgggcatcggcaccaatagcttgcaaattcaaggggtttcg
cggctgaatggcactgaatatacactcggccccgattttatggaggttggttcgttcatc
ggcttggcagcagtgacggggagtaacattcgcatcgccaacgcacgccccgaagaacat
cgcatgacgcggattatgtttgggcgtttgggtgtgacctggcaagacgaaggcccagat
attgtgattcctgctgagcaagagctacgggtgcgcgacgatttgcacggcgttgtgccc
aaaatcgacgatatgccatggcctggcttcccccccgatctgatgagcattgccttggtg
attgcgactcaagcccaaggcacggtgttgattcacgaaaagatgtttgatggacgctta
ttctttgttgataaattgctgagtatgggcgcacgggtgattttgtgcgatccacatcgg
gcggtggtggttggcccagctaaactgtatggcgaacgcctgaccagccccgatattcgc
gctggtatggccttggtcattgccgctttatgcgccaaaggcacgagtattatttcgaat
attgcccaaattgatcggggctaccaacggattgaacagcggctggctgcgcttggagcg
cggatcgaacgccgtcctgctgaataa

DBGET integrated database retrieval system