KEGG   Herpetosiphon aurantiacus: Haur_1000Help
Entry
Haur_1000         CDS       T00614                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00010  Glycolysis / Gluconeogenesis
hau00620  Pyruvate metabolism
hau00640  Propanoate metabolism
hau00680  Methane metabolism
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
hau01120  Microbial metabolism in diverse environments
hau01130  Biosynthesis of antibiotics
hau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_1000
   00620 Pyruvate metabolism
    Haur_1000
   00640 Propanoate metabolism
    Haur_1000
  Energy metabolism
   00680 Methane metabolism
    Haur_1000
Enzymes [BR:hau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Haur_1000
Lipid biosynthesis proteins [BR:hau01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Haur_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-ProteinID: ABX03648
JGI: Haur1000
UniProt: A9AZA2
Position
complement(1143673..1145634)
Genome map
AA seq 653 aa AA seqDB search
MTEHAAPTTVGQFSASNDAESAFYYPPAALVENSNVLAYAREKGFADVEAMRQWSIEHYQ
DFWADMATRMVDWYMPFSKVLDDSKAPFYQWFNDGKINIVHNALDRHVKTWRKNKLALIW
ESEKGDNKTYSYWQLFKRVNKFANVLKSMGVKKGDTVTIYLPRVPEIVIAMLACAKIGAM
HSVVYGGFSVEALQTRIQDAQSRVVITADGGYMNGKVVELKKITDDAIKHSPVVEIVIVV
KRTGHEVEMQQGRDLWYEELMALPIASTKCETEQLDAEHPLYMLYTSGTTGAPKGLVHTH
GGYQVGVATTLHFNLDIKEDDVYWCAADPGWVTGHSYIVYGPLMLGATQVMYEGAPTFPF
PNRWWNIVERYGVTVLYTAPTAIRGLMRFGEAWPNRHDLGSLRLLGSVGEPINPEAWRWY
HRVIGRNNCPIMDTWWQTETGSMMITPNPTTPLKPGSGTRASFGIDADVVNDQGEHASDD
EDGLLIIRNPWPSMLRTIYNNPERYIEQYWSRIPGVYTAGDSARKDEDGYFWVIGRIDDV
IKVSGYRLGTAEVESALVSHPSVAEAAAIGLPHEVKGNAIHTFVILKNGYEANQDLEDAL
IAHVGKVMGPIARPEAVQFVPSLPKTRSGKIMRRVLKARALGLPEGDLSTLEQ
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcatgctgcaccaaccactgttggtcaattttcggcaagcaacgacgctgaa
tcagcattctactacccacctgctgccttggttgaaaactcgaacgtgctggcctacgct
cgtgaaaaaggtttcgccgatgtcgaagccatgcgtcaatggtcgattgagcattatcag
gatttctgggccgacatggcaactcggatggtcgattggtatatgccatttagcaaggtg
ctcgacgatagcaaagcaccgttctaccaatggtttaacgatggcaagatcaacattgtg
cacaatgcgcttgatcgccatgtcaaaacttggcgcaagaataagctggccttgatttgg
gaaagtgaaaagggcgataacaagacctatagctattggcaattgttcaaacgagtcaat
aaatttgccaatgtgctcaaatcgatgggggtcaaaaagggcgataccgtgacgatctat
ttgccacgggttcccgaaattgtgattgcgatgttggcttgtgccaaaattggcgcgatg
cacagcgtggtctatggtggttttagtgtcgaagcgctgcaaactcgcatccaagatgcc
caatcgcgggtagtgattacggctgacggcggttatatgaatggcaaagtcgttgagctg
aaaaagatcaccgacgatgcgattaagcattcaccagtggtcgaaattgtgattgtagtc
aagcgcacaggccacgaagtcgaaatgcaacaaggccgcgacttgtggtatgaagaattg
atggccttgccaatcgcttcgaccaagtgcgaaaccgagcaacttgatgctgaacatcct
ttatatatgctctacacttcgggcacgactggcgctcctaaaggtttagtgcatacccat
ggtggctatcaagttggggttgcgacgaccttgcactttaatcttgatatcaaagaagat
gatgtgtattggtgtgccgccgatccaggctgggtcacgggccactcctacattgtctat
ggtcccttgatgctcggcgcaacccaagtgatgtatgaaggcgcaccaaccttccccttc
cccaaccgctggtggaatattgtcgagcgctatggcgtaaccgtgctctacactgctccc
accgcaattcgcggcttgatgcgctttggcgaagcctggcctaatcgccatgatcttggc
tcgttgcgcttgcttggctcagtcggcgaaccaattaaccccgaagcatggcgctggtat
catcgggtgattggccgcaacaattgcccaattatggatacttggtggcaaactgaaacc
ggcagcatgatgatcacgcctaatccaaccacgccactcaagccaggctcaggcactcgt
gcctcgtttggcatcgatgccgatgtggtcaacgatcagggtgagcatgccagcgatgat
gaagatggtttgttgattatccgcaatccatggccttcgatgttgcgcacgatttataac
aaccctgagcgctatatcgaacaatattggagccgaattccaggtgtgtacaccgctggc
gattcagcccgcaaagacgaagacggctatttctgggtaattggtcggatcgacgatgta
atcaaggtttcaggctatcggttgggcacggctgaagttgagtcggctttggtttcgcat
ccatcagttgccgaagctgccgcaatcggcttgcctcacgaagtcaaaggcaatgcgatt
catacctttgtgattttgaagaatggctacgaagccaaccaagatcttgaggatgcgctg
attgcccacgttggcaaagtgatggggccaattgcccgccctgaggcagtacaatttgtg
ccaagtttgcctaaaacccgctcaggcaaaattatgcgccgcgtcctcaaagcccgtgcc
ctaggcttgcccgaaggcgatttgagcactttggaacaataa

DBGET integrated database retrieval system