KEGG   Herpetosiphon aurantiacus: Haur_1016Help
Entry
Haur_1016         CDS       T00614                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_1016
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Haur_1016
   00630 Glyoxylate and dicarboxylate metabolism
    Haur_1016
Enzymes [BR:hau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Haur_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1161510..1163102
Genome map
AA seq 530 aa AA seqDB search
MTDRQHGVKINAPITPAAAELLTEPALHFLAALHRTFDQTRRDLLLGRVERQSRLDAGEN
PDFLAETAHIRASDWQIAPIPDEIRNRRVEITGPIDRKMIINALNSGANVFMADCEDATT
PSWDNLVSGQLNLRDAVNRTISFTNEAGKAYQLNDQVAVLFVRPRGWHLLEKHVTVDGEP
LAGGLFDFGLYLFHNAKTLLERGSAPYFYLPKLESHREARLWNDVFVFAQKQLGLPHGSI
KATVLIETILAAFEMDEILYELRDHSAGLNCGRWDYIFSCIKKFAKLQHFVLADRALVTM
TSRFMRSYSLLAIKTCHRRGAHAMGGMAAQIPIKHDAQANAEALAKVQADKEREARDGHD
GTWVAHPGLVPLAKAAFDALMPEANQIGKQLDVEITADDLLRFEPSAPITEQGLRKNISV
GIQYIEAWLGGLGCVPLYNLMEDAATAEISRAQVWQWVHQPNGITEDFRKITLDWVRELI
VEELAKIEQEVGAERYRNGHYDRASQLFDQLVANPTFTEFLTLPAYEQID
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcggcaacatggcgtgaaaatcaacgcccctatcacccccgctgcggcggaa
ttgttgacggaaccagccctacacttcttagctgccttgcatcgcacttttgaccaaact
cgccgcgacttattgctcggacgagtggaacgccaaagccgccttgatgcaggcgaaaac
cctgattttctcgctgaaactgcccatattcgtgctagcgactggcaaattgcgcccatc
cccgatgagattcgtaatcgtcgcgtggaaattactgggccaattgatcgcaaaatgatc
atcaatgcgctcaactctggagccaatgtcttcatggccgactgtgaagatgcaaccact
ccaagctgggataatttggtcagcggccaacttaacttgcgcgatgcggtcaatcggacg
ataagcttcaccaatgaagctggcaaagcctatcaattaaacgatcaggttgcggtgctg
tttgtgcggcctcgtggctggcacttgctcgaaaagcatgtcaccgtcgatggcgaaccc
ttggctggtggtctgttcgactttggtttgtatttgttccacaatgccaaaaccttgctc
gaacgtggctcggctccttacttctatctgccaaaactcgaaagccatcgcgaagcccgt
ttgtggaatgatgtgttcgtgtttgcccaaaagcaactcggcctgccccatggctcaatc
aaggcaacggttttgattgaaacaattttggccgccttcgagatggacgaaattctgtat
gaattgcgcgaccactcggctggcctcaactgtggccgctgggattacatcttcagctgc
atcaagaaatttgctaaattacaacattttgtgctggctgatcgtgctttagtgacgatg
acttcacgctttatgcgctcatattcgttgctggcgatcaaaacctgccatcgccgtggt
gctcacgcaatgggcgggatggctgctcagattccgatcaagcacgatgcccaagccaat
gccgaagccctcgccaaagtgcaagccgataaagagcgcgaagctcgcgacggccacgac
ggcacatgggtcgctcatccaggtttggttccgttagctaaggccgcctttgatgctttg
atgcctgaagctaaccaaattggcaagcagcttgatgttgaaattactgccgatgattta
ctgcgcttcgagccatcagcgccgattaccgagcaaggcctgcgcaaaaatatcagcgtt
ggcatccaatatatcgaagcttggttgggtggcttaggctgcgtgccgctgtacaactta
atggaagatgccgcaaccgccgaaatctcccgtgctcaagtttggcaatgggtacatcaa
cctaatggcattaccgaagattttcgcaaaatcaccctcgattgggtgcgcgagttgatc
gtcgaagaactggccaagatcgaacaagaagttggcgcagaacgctatcgcaacggtcat
tatgatcgggctagccaattgtttgatcaattggttgccaacccaacctttaccgaattt
ctcacgcttcctgcttacgaacaaatcgattaa

DBGET integrated database retrieval system