KEGG   Herpetosiphon aurantiacus: Haur_1016Help
Entry
Haur_1016         CDS       T00614                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_1016
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Haur_1016
   00630 Glyoxylate and dicarboxylate metabolism
    Haur_1016
Enzymes [BR:hau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Haur_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1161510..1163102
Genome map
AA seq 530 aa AA seqDB search
MTDRQHGVKINAPITPAAAELLTEPALHFLAALHRTFDQTRRDLLLGRVERQSRLDAGEN
PDFLAETAHIRASDWQIAPIPDEIRNRRVEITGPIDRKMIINALNSGANVFMADCEDATT
PSWDNLVSGQLNLRDAVNRTISFTNEAGKAYQLNDQVAVLFVRPRGWHLLEKHVTVDGEP
LAGGLFDFGLYLFHNAKTLLERGSAPYFYLPKLESHREARLWNDVFVFAQKQLGLPHGSI
KATVLIETILAAFEMDEILYELRDHSAGLNCGRWDYIFSCIKKFAKLQHFVLADRALVTM
TSRFMRSYSLLAIKTCHRRGAHAMGGMAAQIPIKHDAQANAEALAKVQADKEREARDGHD
GTWVAHPGLVPLAKAAFDALMPEANQIGKQLDVEITADDLLRFEPSAPITEQGLRKNISV
GIQYIEAWLGGLGCVPLYNLMEDAATAEISRAQVWQWVHQPNGITEDFRKITLDWVRELI
VEELAKIEQEVGAERYRNGHYDRASQLFDQLVANPTFTEFLTLPAYEQID
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcggcaacatggcgtgaaaatcaacgcccctatcacccccgctgcggcggaa
ttgttgacggaaccagccctacacttcttagctgccttgcatcgcacttttgaccaaact
cgccgcgacttattgctcggacgagtggaacgccaaagccgccttgatgcaggcgaaaac
cctgattttctcgctgaaactgcccatattcgtgctagcgactggcaaattgcgcccatc
cccgatgagattcgtaatcgtcgcgtggaaattactgggccaattgatcgcaaaatgatc
atcaatgcgctcaactctggagccaatgtcttcatggccgactgtgaagatgcaaccact
ccaagctgggataatttggtcagcggccaacttaacttgcgcgatgcggtcaatcggacg
ataagcttcaccaatgaagctggcaaagcctatcaattaaacgatcaggttgcggtgctg
tttgtgcggcctcgtggctggcacttgctcgaaaagcatgtcaccgtcgatggcgaaccc
ttggctggtggtctgttcgactttggtttgtatttgttccacaatgccaaaaccttgctc
gaacgtggctcggctccttacttctatctgccaaaactcgaaagccatcgcgaagcccgt
ttgtggaatgatgtgttcgtgtttgcccaaaagcaactcggcctgccccatggctcaatc
aaggcaacggttttgattgaaacaattttggccgccttcgagatggacgaaattctgtat
gaattgcgcgaccactcggctggcctcaactgtggccgctgggattacatcttcagctgc
atcaagaaatttgctaaattacaacattttgtgctggctgatcgtgctttagtgacgatg
acttcacgctttatgcgctcatattcgttgctggcgatcaaaacctgccatcgccgtggt
gctcacgcaatgggcgggatggctgctcagattccgatcaagcacgatgcccaagccaat
gccgaagccctcgccaaagtgcaagccgataaagagcgcgaagctcgcgacggccacgac
ggcacatgggtcgctcatccaggtttggttccgttagctaaggccgcctttgatgctttg
atgcctgaagctaaccaaattggcaagcagcttgatgttgaaattactgccgatgattta
ctgcgcttcgagccatcagcgccgattaccgagcaaggcctgcgcaaaaatatcagcgtt
ggcatccaatatatcgaagcttggttgggtggcttaggctgcgtgccgctgtacaactta
atggaagatgccgcaaccgccgaaatctcccgtgctcaagtttggcaatgggtacatcaa
cctaatggcattaccgaagattttcgcaaaatcaccctcgattgggtgcgcgagttgatc
gtcgaagaactggccaagatcgaacaagaagttggcgcagaacgctatcgcaacggtcat
tatgatcgggctagccaattgtttgatcaattggttgccaacccaacctttaccgaattt
ctcacgcttcctgcttacgaacaaatcgattaa

DBGET integrated database retrieval system