KEGG   Herpetosiphon aurantiacus: Haur_1017Help
Entry
Haur_1017         CDS       T00614                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00630  Glyoxylate and dicarboxylate metabolism
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
hau01120  Microbial metabolism in diverse environments
hau01200  Carbon metabolism
Module
hau_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Haur_1017
Enzymes [BR:hau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Haur_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABX03665
JGI: Haur1017
UniProt: A9AZB9
Position
1163272..1164564
Genome map
AA seq 430 aa AA seqDB search
MNTTNGISTTELERGWATDARWQGIQRDYTAEDVVRLRGSVIIEQTLARMGAERLWDLLH
TEDYVHALGALTGNQAMQMVKAGLKAIYLSGWQVAADANMAGQMYPDQSLYPANSVPQVV
KRINQTLQRCDQIYHSEAKDGTYWFAPIIADAEAGFGGPLNAFEMMKAMIEAGAAGVHFE
DQLSSEKKCGHLGGKVLIPTSHFIRTLQAARLAADVMDVPTLVVARTDANGAYLLTSDVD
PRDREFCTGERTPEGFFCIRGGIDSAIARGLAYAPYADLIWCETSTPDLEEARKFAEAIH
AQYPGKLLAYNCSPSFNWKRNLDDATIAKFQSELGAMGYKFQFITLAGFHALNYSMFDLA
TGYRDQGMSAYVQLQQAEFNRESEGYTAVKHQREVGTGYFDLVAQAVSGGMSSTTALSGS
TEHEQFVGAH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccacgaacggtatctcaacaacagaactggaacggggttgggcaacggacgca
cgttggcaagggattcagcgcgattacacagccgaagatgttgtgcgcttgcgcggttca
gtgattattgagcaaactttagctcggatgggtgctgaacgcttgtgggatctccttcac
accgaagattacgtgcatgcgttgggtgcgctgactggtaatcaagccatgcagatggtc
aaagcaggcttgaaggcgatttacttgagtggctggcaggttgccgccgatgccaatatg
gctgggcaaatgtatcccgatcaaagcttgtatcccgctaacagcgtgccacaagttgtc
aaacggatcaaccaaaccttgcaacgctgcgaccaaatttatcactcagaagctaaagat
ggtacctactggttcgcgcccatcatcgccgatgctgaagctggctttggtggcccactg
aatgcctttgaaatgatgaaggctatgatcgaagctggcgcggctggggtgcacttcgaa
gatcaattatcatcagaaaagaaatgtggccacttgggcggcaaggtcttgatcccaacg
agccactttattcgcacgctgcaagctgcccgtttggctgccgacgtgatggacgtacca
accttggtcgtcgctcgtaccgatgccaacggtgcatacctcttgaccagcgacgttgat
ccacgtgaccgcgagttttgtacaggcgaacgcacccccgaaggcttcttctgtattcgc
ggtgggatcgattcagcaattgcccgtggcttggcctatgctccatatgccgacctgatt
tggtgtgaaacctcaaccccagatttggaagaagcacggaaatttgctgaagcgatccat
gctcaatatccaggcaaattgttggcctacaactgctcgccatcattcaactggaagcgc
aacttggatgatgccacgattgccaagttccaaagcgaactcggcgcgatgggttacaag
ttccaattcatcaccttggcgggcttccacgccttgaactacagcatgttcgatttggca
accggctatcgcgaccaaggcatgagcgcctatgtgcaattgcaacaagctgaattcaac
cgcgaaagcgaaggctataccgccgtcaagcaccaacgcgaagttggcactggctacttc
gatttggttgcgcaagcagtttcaggtggcatgtcatcgaccaccgccttgagcggctcg
accgagcacgaacaatttgttggagcccattag

DBGET integrated database retrieval system