KEGG   Herpetosiphon aurantiacus: Haur_1197Help
Entry
Haur_1197         CDS       T00614                                 

Definition
lysophospholipase L2
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hau  Herpetosiphon aurantiacus
Brite
Enzymes [BR:hau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Haur_1197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1378709..1379461
Genome map
AA seq 250 aa AA seqDB search
MSSVGCLILHGFTSCADSVNRVPSRLAPHHIPYRMPYLRGHGTLPEDLQGVTWHDWYADA
NAALRDLRREVDKVILIGLSMGGLVANHLAAAHRDDVIGVVSVAAAMRFHYKHADRARYV
APMLGMWGDENRDMGAGWYDKETGRQHGNYRRFPAPAFVSLWRYAKVVEQQLPRITAPIL
IIHSHQDRTIPTSAAEAIYRQVGSSDKQLLWFDKSGHEMLRDGESPAVLDAVEQFVLHHR
AQYQSSTNKE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgttggttgtttaattcttcacggctttacttcatgcgccgattcagtcaat
cgggtgccaagccgtttagctccccatcatattccgtatcgcatgccctatttgcgtggt
catggcaccttgcccgaagatttgcagggcgtaacctggcacgattggtatgctgatgcc
aatgcagccttgcgtgatttacggcgcgaggtcgataaagttattttgattgggctttct
atgggtggcctcgtggccaatcacctagcagcagctcatcgcgatgacgttattggggtg
gttagcgtggccgctgccatgcgcttccactataaacatgccgatcgggcacgctatgtt
gcgccaatgctagggatgtggggcgatgaaaatcgcgatatgggcgcaggttggtacgat
aaagagacaggccgccaacatggcaattatcggcgctttccggctccggcctttgtttcg
ctttggcgctatgccaaagtcgtggaacaacaattgccacgaattactgcaccaatctta
atcattcattcacatcaagatcgtacaattcccacatccgccgccgaagcgatctatcgc
caagttggctccagcgataaacaattactgtggttcgataaaagtggccacgaaatgctc
cgcgatggtgaatcgccagcagtcttagatgcggttgagcaattcgtgctgcatcatcgt
gcccaatatcaatcatcaacaaacaaggagtag

DBGET integrated database retrieval system