KEGG   Herpetosiphon aurantiacus: Haur_1247Help
Entry
Haur_1247         CDS       T00614                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Haur_1247
   00051 Fructose and mannose metabolism
    Haur_1247
Enzymes [BR:hau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Haur_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1455013..1456161
Genome map
AA seq 382 aa AA seqDB search
MTQHKFSFGLWTVGNVGRDPFGEPVRKTLSPVEIVHLLAEVGAWGVNFHDNDLVPIDASA
SQKAQIIADFKQALKDTGLVVPMATTNLFGHPAFKDGAFTSNDPAVRAYALQKTMAAMDL
GAEFGAKTYVFWGGREGSETDASKNLLEGLKWFREALNFLCDYSNAQGYGYRFALEAKPN
EPRGDIFLPTTGAMLGFIQTLDQPEMVGVNPEVAHETMAGLNFTHAVAQALDAGKLFHID
LNDQNSGRYDQDYRFGAQNYKQSFFLVKLLQDAGYDGPLHFDAHAYRSEDLEGVKDFARG
CMRTYQILAEKVQRFNADAEIQALLAQINAPNADVEQFRGGYTPERAAALKAYQFDRQAL
GERGLGYEKLDQLTFELLMGAR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcataaatttagctttggattatggacagttggcaatgttgggcgtgaccca
tttggtgaaccagtgcgcaaaaccctctcgccagttgagattgtgcatttgttggctgaa
gttggagcatggggcgtaaattttcacgataacgatttagtgccgattgatgctagtgcc
agccaaaaagcccaaattattgccgatttcaaacaagcactcaaggataccggcttggtt
gtgccgatggcaaccaccaatttattcggtcacccagcctttaaagatggcgcatttacc
agcaacgatccggctgtgcgggcttatgccttgcaaaaaaccatggcagccatggatttg
ggcgctgaatttggcgcgaaaacctatgtgttttggggtggccgtgaaggcagcgaaacc
gatgcctcgaaaaatctgctcgaaggcttgaagtggttccgcgaagcgctcaacttcttg
tgcgactatagcaatgcccaaggctatggctatcgttttgccttggaagccaagcccaac
gaaccacgcggcgatatcttcttgcctaccaccggagccatgttgggctttattcagacc
ctcgatcagcccgagatggtgggggtaaatcccgaagttgcccatgaaaccatggcaggc
ttgaattttacccatgccgtggcccaagcgcttgatgctggcaaactgttccatatcgac
ctcaacgatcaaaatagtggtcgctacgaccaagattatcgctttggagcacaaaactac
aaacaaagctttttcttggtgaaattgctgcaagatgctggctacgatggcccattgcac
ttcgatgctcacgcttaccgcagcgaagatcttgagggagttaaagattttgcccgtggt
tgtatgcgtacctaccaaattttggccgaaaaagttcagcgcttcaatgctgatgctgaa
attcaagccttgttagctcaaatcaacgccccaaatgccgatgttgagcaattccgtggt
ggctacacgccagaacgtgccgctgcgctcaaagcctatcaatttgatcgtcaagcactt
ggcgaacgcggcctcggctacgaaaagcttgatcaactaaccttcgagttgttgatggga
gccagatag

DBGET integrated database retrieval system