KEGG   Herpetosiphon aurantiacus: Haur_1279Help
Entry
Haur_1279         CDS       T00614                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Haur_1279
Enzymes [BR:hau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Haur_1279
Exosome [BR:hau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Haur_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1488409..1490091
Genome map
AA seq 560 aa AA seqDB search
MQNDANPDASPTVASLPDGVWMGARDLGNGAVAFGLYAPWKQSVHLIGSFNDWNQTADPL
NISDRGIWWIIKEGLAAGEYAYQFVIDGETIIGDPYARELRWAGGDQPQAIIHVGEPAYE
WHDDGFGIRPLNELVIYELHVGDFSEAGTFKAVTERIPYLQDLGVNALELMPLFEFPGDR
SWGYNPAYFFAPESTYGTPADLRELIDTAHQHGIGVILDVVFNHVDHSSPINYLYPYDQS
PFFSSDGNPWGFPDLNHWNEAVKQLISDVQTYWLSDMHIDGFRYDHAEGIGFDGENGVSF
LGWQARQIKPHVYLIAENLKDYTTMVDQTDMDSSWHRSFHSQMFANLREGDFEGNQYGNV
EATLGIIDFRNAGYNDNAQAINYLESHDEQRIVYEAQTNENISRETAYLKSRLGAIVLFT
AAGVPMLYHGQEFGMDTERTIDKNMLKWELLQTAEGTDLHAFYRGMIQLRTSSKALVGNN
IRPVAMDAERKLLAYYRWADDGSEHVIVVVNFGITLQYLDVHFPVGGLWHEWVYNYDRET
PEGMATIEVPGSGGKVFVLR
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgatgccaatcctgatgcttcgccaacggtggctagtttgcccgatggggtt
tggatgggtgcacgcgatttaggcaatggcgcggtggcgtttggcctttatgcaccatgg
aagcagagtgttcatttaattggctcgtttaacgattggaaccaaaccgctgatccatta
aatatttcggatcgcgggatttggtggattatcaaagaaggtttagcagctggcgaatat
gcttatcaatttgtgattgacggcgagacgatcatcggcgacccctatgcccgtgaattg
cgttgggctggtggcgatcagccacaggcgattattcatgttggcgagccagcctacgag
tggcacgacgatggttttggcattcgtccgctgaatgaattggtgatttatgaattgcat
gttggcgattttagcgaggctggcaccttcaaagccgtcactgaacgaattccttatctt
caagatttaggggtgaatgcgcttgaattaatgccgttgtttgagtttcctggcgatcgt
tcgtggggctataatccggcctatttctttgctcccgaatcgacctatggcacgcctgcc
gatttgcgcgagttgatcgatacggcccaccaacatggcattggggtgattttggatgta
gtgtttaatcatgtcgatcactctagcccgattaactatttgtatccctacgatcaaagc
cctttctttagcagcgacggcaacccgtggggcttccccgatttgaaccattggaatgaa
gcagtcaaacaattaatcagcgatgtgcaaacctattggctcagcgatatgcacatcgat
ggctttcgctacgatcacgccgagggaattggctttgatggcgagaatggggtttcgttc
ttgggctggcaggctcgccaaatcaaaccgcatgtctatttgattgccgaaaatctcaaa
gattacaccaccatggttgatcaaactgatatggattcgtcgtggcatcgttcgtttcat
tcgcaaatgtttgccaacttgcgcgaaggtgatttcgagggcaatcagtatggcaatgtt
gaggccacgctggggattatcgattttcgcaatgctggctacaacgataatgcccaagcg
atcaattatcttgaatcgcacgatgagcagcggattgtttacgaggcccaaaccaacgaa
aatatcagccgcgaaaccgcttatttgaaatcgcgactgggcgcgattgtgctatttacc
gctgctggtgtgcccatgctatatcatggccaagaatttggcatggataccgaacgtaca
atcgacaaaaatatgctgaaatgggagttattgcaaacagctgagggcactgatttgcac
gccttctatcgtggcatgattcaattacgtacctcatcgaaggccttggttggcaataat
atccggcctgtcgccatggatgctgagcgcaaattgttggcctactatcgctgggccgac
gatggcagcgaacatgtgattgttgtggtgaattttggcatcaccctgcaataccttgat
gtgcatttcccggttggtggtttatggcacgaatgggtctataactacgatcgtgaaacc
cctgaaggtatggccacaatcgaagtgcctggctcaggtgggaaggtctttgtgttgcgc
taa

DBGET integrated database retrieval system