KEGG   Herpetosiphon aurantiacus: Haur_1568Help
Entry
Haur_1568         CDS       T00614                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hau01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hau00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hau00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1819874..1820866
Genome map
AA seq 330 aa AA seqDB search
MIRPRGHCGVINLPAVSSIISLGEGCTPLTKVKVGRHSFLAKLEFLNPTGSYKDRGVSVM
MSHILSHQVRQVIDDSSGNAGASISAYAAHAGIQARIFVPAHASSYKKQQIQRFNATLVE
VEGLRSATTTACWKEAQHTTYASHAWSPFFLAGQMTCAWEMWEQLGRRVPAAIVCVAGQG
GLLIGLLQGFKALLKAKLIPHLPRLYAVQARACDPIVRAWEERKEFPQACVEQTTLAEGI
RIAQPVRGRDILRAIYESAGAAIRVEEHEILAAQAMLAHQGLLVEATSAAAVAGLSQICQ
LTELAPDDIVIPLTGSGLKQAAVAELSMRS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttgatcagaccacgtggtcactgtggcgttataaatttaccagccgtctcaagcattatc
tcattaggcgaaggttgtactccactgaccaaggtcaaggttggtcggcatagctttctt
gcgaaacttgaatttcttaatccaactggttcgtataaagatcgtggtgtgtcggtaatg
atgagtcatatcttgagtcatcaggttcggcaagtgattgacgactcttctggcaatgct
ggtgcttctatctcggcctatgcggctcatgccggtatccaagcacggatttttgtgccg
gcccatgctagtagttataaaaaacagcaaattcaacggtttaatgccactttagttgaa
gttgaagggttacggagcgcgacgaccaccgcctgttggaaggaagctcagcatacaacc
tatgccagccatgcttggagtcctttttttctggcgggccaaatgacctgtgcttgggag
atgtgggaacaacttgggaggcgagtacccgctgccattgtttgtgttgccggtcaaggt
ggcctcttaattggcttattgcagggatttaaggccttgctaaaagccaagctgattcca
cacctaccgcgattatatgcagttcaggcgcgtgcctgtgacccaattgtgcgagcttgg
gaggaaagaaaggagtttccccaggcttgtgttgaacagacaaccttggccgaaggaatt
cggattgcccaaccagttcgtggccgcgatattctccgcgcgatctacgaatcagcaggt
gcggctattcgggtagaggaacacgaaattctcgctgctcaagcgatgttggcccaccaa
ggtttattagtcgaggccaccagtgctgctgcggtcgctggattatcccaaatttgccaa
ttaaccgagcttgcgcccgacgatattgttattccgttgactggcagtggccttaaacaa
gccgctgtagccgaattaagcatgaggagttaa

DBGET integrated database retrieval system