KEGG   Herpetosiphon aurantiacus: Haur_1568Help
Entry
Haur_1568         CDS       T00614                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00260  Glycine, serine and threonine metabolism
hau00750  Vitamin B6 metabolism
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
hau01120  Microbial metabolism in diverse environments
hau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Haur_1568
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Haur_1568
Enzymes [BR:hau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Haur_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX04211
JGI: Haur1568
UniProt: A9B4P6
Position
1819874..1820866
Genome map
AA seq 330 aa AA seqDB search
MIRPRGHCGVINLPAVSSIISLGEGCTPLTKVKVGRHSFLAKLEFLNPTGSYKDRGVSVM
MSHILSHQVRQVIDDSSGNAGASISAYAAHAGIQARIFVPAHASSYKKQQIQRFNATLVE
VEGLRSATTTACWKEAQHTTYASHAWSPFFLAGQMTCAWEMWEQLGRRVPAAIVCVAGQG
GLLIGLLQGFKALLKAKLIPHLPRLYAVQARACDPIVRAWEERKEFPQACVEQTTLAEGI
RIAQPVRGRDILRAIYESAGAAIRVEEHEILAAQAMLAHQGLLVEATSAAAVAGLSQICQ
LTELAPDDIVIPLTGSGLKQAAVAELSMRS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttgatcagaccacgtggtcactgtggcgttataaatttaccagccgtctcaagcattatc
tcattaggcgaaggttgtactccactgaccaaggtcaaggttggtcggcatagctttctt
gcgaaacttgaatttcttaatccaactggttcgtataaagatcgtggtgtgtcggtaatg
atgagtcatatcttgagtcatcaggttcggcaagtgattgacgactcttctggcaatgct
ggtgcttctatctcggcctatgcggctcatgccggtatccaagcacggatttttgtgccg
gcccatgctagtagttataaaaaacagcaaattcaacggtttaatgccactttagttgaa
gttgaagggttacggagcgcgacgaccaccgcctgttggaaggaagctcagcatacaacc
tatgccagccatgcttggagtcctttttttctggcgggccaaatgacctgtgcttgggag
atgtgggaacaacttgggaggcgagtacccgctgccattgtttgtgttgccggtcaaggt
ggcctcttaattggcttattgcagggatttaaggccttgctaaaagccaagctgattcca
cacctaccgcgattatatgcagttcaggcgcgtgcctgtgacccaattgtgcgagcttgg
gaggaaagaaaggagtttccccaggcttgtgttgaacagacaaccttggccgaaggaatt
cggattgcccaaccagttcgtggccgcgatattctccgcgcgatctacgaatcagcaggt
gcggctattcgggtagaggaacacgaaattctcgctgctcaagcgatgttggcccaccaa
ggtttattagtcgaggccaccagtgctgctgcggtcgctggattatcccaaatttgccaa
ttaaccgagcttgcgcccgacgatattgttattccgttgactggcagtggccttaaacaa
gccgctgtagccgaattaagcatgaggagttaa

DBGET integrated database retrieval system