KEGG   Herpetosiphon aurantiacus: Haur_1693Help
Entry
Haur_1693         CDS       T00614                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Haur_1693
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Haur_1693
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Haur_1693
Enzymes [BR:hau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Haur_1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1967519..1968334
Genome map
AA seq 271 aa AA seqDB search
MSRIAQTFERLASQGRTALMPFLTIGYPERDSALSLAQALVAGGADMLELGMPFSDPLAD
GATIQRTTDIALTNGVDIGFCLETVRQLRATGMSIPLLLMGYFNPMFQYGVERFVAEAKA
AGADGFIVPDLPPEEADEFHAAAKAHELDLVFLLAPTSTDARIAKIASLSSGFIYCVALR
GVTGARAALADDLGDFLARVRQYSQLPRAVGFGISKPEHVAAVAKMAEGAICASALLDYI
GNLPAEERATGAQQFVQSLRDAADRATGYQQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaattgcccaaacttttgaacgcttagccagccaaggtcggacagccctgatg
ccatttttgacgattggctaccctgagcgtgattctgccctgagtttagcccaagccttg
gttgctggcggcgcagatatgcttgagcttggcatgcccttttctgatccgttggccgat
ggcgcgacgattcaacgtaccaccgatattgccctaaccaatggagtggatattgggttt
tgtttggagacggtgcgccaattacgagcgactggcatgagcattccgttattgctgatg
ggctatttcaaccctatgtttcaatatggcgttgaacggtttgtggccgaagctaaagcg
gcgggtgctgatggttttatcgtgcctgatttaccacctgaggaggccgacgaatttcat
gctgcggccaaagcccatgagttggatttggtgttcttgttggctccaacctcgactgat
gcccgtatcgccaagattgccagcctgtcgtcggggtttatctactgtgtggcattgcgc
ggcgtaactggtgcgcgggctgcgttggcagacgatttgggtgatttcttggcgcgagta
cgccaatatagccaattgccgcgtgcggttggctttggcatctccaaacctgaacatgtg
gccgcagttgccaaaatggctgaaggggcaatttgcgccagtgccttgctcgattatatt
ggcaatttgcccgccgaagagcgtgctactggagcgcaacagtttgtgcaaagcttgcgc
gatgctgctgatcgggctacgggctatcaacaataa

DBGET integrated database retrieval system