KEGG   Herpetosiphon aurantiacus: Haur_1762Help
Entry
Haur_1762         CDS       T00614                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hau00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hau00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2049721..2050881
Genome map
AA seq 386 aa AA seqDB search
MYDAQPAHKFTFGLWTVGNVGRDPFGEPVRKPLSPPEIVHLLAEVGAWGVNFHDNDLIPI
DATPSERDSIIKAFRGALAETGLVVPMATTNLFSHPAFKDGAFTSNDPAVRAYALQKTMA
AMDLGAEFGATTYVFWGGREGSESDAAKNPLEGLKWFREALNFLCEYSLAQGYNYRFALE
AKPNEPRGDIFLPTTGAMLGFIETLDHSAMVGVNPEVAHETMAGLNFAHAVAQALDAGKL
FHIDLNDQASGRYDQDFRFAAHNYKQNFFLVKLLEDVGYDGPRHFDAHAYRSEDLQGVKD
FARGCIRSYLILAEKARRFNADAEIQGLLAELKTVEPAVAALAGSYSPERVAALKAHEFD
RTGLGARGLGYEKLDQLTFELLMGVR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgcacagcctgcccacaaatttacgtttggcctttggacggtcggcaatgtt
ggccgtgatccctttggcgagccagttcgtaagccgctgagtcctcctgagattgtccat
ttactggcagaagttggcgcttggggcgtaaacttccacgataacgatttaattccaatt
gatgcaactcccagcgaacgcgactcaattatcaaggcctttcgtggcgctttagctgaa
accggtctcgttgtgccaatggcaactaccaacttattcagtcatccagcttttaaagat
ggcgcgtttaccagcaatgatccagcagtacgcgcctatgcgctgcaaaaaaccatggcc
gcgatggatttgggagccgaatttggggccacgacctatgtattttggggtggtcgcgaa
ggcagcgaaagcgatgccgccaaaaatccgcttgaaggcttgaagtggtttcgcgaggcg
ctcaactttttgtgtgaatatagcttggcccaaggctataactatcgctttgccttggaa
gcgaagcccaacgaaccacgcggcgacatctttttgcccaccaccggagccatgttgggc
tttatcgaaaccctcgatcattcagcaatggttggggttaaccctgaagtagcccacgaa
accatggcgggcttaaattttgcccatgctgtggcccaagcgcttgatgctggcaaactt
ttccacatcgacctcaacgatcaagccagtggtcgctatgatcaagatttccgctttgca
gcgcataactacaagcaaaatttcttcttggtcaagttgctcgaagatgttggctatgat
ggcccacgccacttcgatgcccatgcctaccgctcagaagatttgcaaggggtcaaagat
tttgcccgtggctgtattcgcagctatctgattttggccgaaaaagcccgccgcttcaac
gctgatgctgaaattcaaggtttgttggccgaattgaaaacagttgagccagcagtggcg
gcgttggctggtagctattcgccagaacgagttgccgcgctcaaggcgcatgaatttgat
cggacggggctgggtgcacgcggtttgggctacgaaaagcttgatcaattgacatttgaa
ttattgatgggtgttcgttaa

DBGET integrated database retrieval system