KEGG   Herpetosiphon aurantiacus: Haur_1923Help
Entry
Haur_1923         CDS       T00614                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_1923 (tpiA)
   01230 Biosynthesis of amino acids
    Haur_1923 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_1923 (tpiA)
   00051 Fructose and mannose metabolism
    Haur_1923 (tpiA)
   00562 Inositol phosphate metabolism
    Haur_1923 (tpiA)
Enzymes [BR:hau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Haur_1923 (tpiA)
Exosome [BR:hau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Haur_1923 (tpiA)
  Exosomal proteins of bladder cancer cells
   Haur_1923 (tpiA)
  Exosomal proteins of melanoma cells
   Haur_1923 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2320765..2321517)
Genome map
AA seq 250 aa AA seqDB search
MRRPLLAGNWKMHYGVSEGVALVEALSADLTDLTDRDVLVCPPFTLLGSLAPLLDGTAVA
LGAQNMHYEAKGAYTGEIAPQMLKELGCSYVILGHSERRQYFGETDALINRKAHAALANG
LKPIVCVGEVKAERDSGQAESVVVGQLRGSLAGLSAEQLRGVVIAYEPVWAIGTGDTATP
ADAQAMHARIRAELAALSDQATADAVIIQYGGSVKPDNVDELMAQPDIDGALVGGASLKA
ADFIRIVRFK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgaccattgttggctggtaattggaaaatgcactacggggtcagtgagggtgtg
gccttagtcgaagcactcagcgccgatttgaccgatctaaccgatcgtgatgtgttggtt
tgcccaccattcaccttgttgggcagtttagcaccattactcgatggcactgccgtggcc
ttgggtgcgcaaaatatgcactacgaagccaagggagcttatactggcgaaattgcgccc
caaatgctcaaggaattgggctgtagctatgtgattttaggccatagcgaacgccgccag
tattttggcgaaactgatgcgttgatcaatcgcaaagcccatgccgccttagccaacggc
ctcaagccaatcgtgtgtgttggcgaagtcaaagccgaacgcgatagtggccaagcagag
agcgtcgttgttgggcagttacgcggcagtttggctggattaagtgccgagcaattgcgc
ggggtcgtgattgcctacgaaccagtttgggcgattggcactggcgatacagccactcca
gccgatgcccaagccatgcacgcccggattcgcgccgaattggccgcgctcagcgatcaa
gcaaccgctgatgcggtgattatccagtatggtggctcggtcaagcctgataacgtcgat
gaattgatggctcagccggatatcgacggagccttggttggcggagcctcgctcaaagct
gccgatttcattcggattgtgcggtttaaatag

DBGET integrated database retrieval system