KEGG   Herpetosiphon aurantiacus: Haur_2013Help
Entry
Haur_2013         CDS       T00614                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Haur_2013
  Amino acid metabolism
   00340 Histidine metabolism
    Haur_2013
Enzymes [BR:hau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Haur_2013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2502613..2503947
Genome map
AA seq 444 aa AA seqDB search
MPIQLYTDLAQAQQGPLARVAFDTVEVPERLQQSLDHMFGVGTTPAAAVDQILASVRRDG
DAALEHWSRTIEGVELSQFEVDRSAIEAAYSQLDPLLVEALRISAAEIERFHRKQTRQSW
VDWSDEGALGQIVLPLERIGAYAPGGTAPLPSSLLMGVIPAKVAGVREIIVCSPPQRDTG
EISPLVLVAADIAGVHRIFRLGGAQAIAAMAYGTNSVPHVDKIIGPGNLFVVLAKKAVYG
TVDIEALPGPTETMVIADADANPELVAADLLAQAEHDLLASAILLTPSLELAEKVQVAVA
RQLEELERAEIAAQALTNRSGIVLVPSLEVAFDLSNAYGPEHLCLLVNDPWQYVGKVRNA
GGIFLGERSFEVLGDYVAGPSHIMPTGGTARYASPVNVDHFRKVISLVGLNEKALQRLGP
VAQRLAEAEGLTAHAAAVRRRLEQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcagctttataccgatcttgcgcaggctcaacaaggcccattagcacgagtc
gccttcgatacggtcgaagttccagagcgtttacaacaaagcctcgaccacatgtttggg
gttggcacaacgcctgccgctgcggttgatcagatcttagccagtgtgcggcgcgatggc
gatgcggccttagagcactggagccgcacgatcgaaggcgttgaattaagccaatttgag
gtcgatcgctcggcgattgaagccgcctatagccaacttgatccattattggttgaagcg
ttacggatctctgctgccgagatcgagcgttttcatcgtaagcaaacccgccaaagttgg
gttgattggtcggatgaaggagcactgggtcagattgttctaccacttgagcggattggg
gcgtatgcgccaggtggcacagctccccttccatcgtcattattgatgggggtaattcca
gctaaggtagctggagtacgcgagattattgtgtgctcgccgccgcaacgtgatactggc
gagatctcgccgttggtcttggtagctgccgatattgctggagtccaccgaatttttcgt
ttgggcggggcacaggccattgctgcgatggcctatggcacgaatagtgtgccacatgtc
gataaaattatcggtccaggcaatctgtttgtggtgttggccaaaaaggcggtgtatggc
acggttgatattgaagccttgcccggccctaccgaaaccatggtgattgccgatgctgat
gctaaccctgagctagtggctgccgatttactcgcccaagccgaacatgatttgctggct
tcggcgattttgcttacgccttcgttggaattggccgaaaaagtccaggtcgcggttgct
cgtcaactcgaagagcttgaacgagctgaaatcgcggcccaagcgctcaccaatcgctca
gggattgtgcttgtcccttcattagaggttgcattcgatttaagtaatgcctatggccct
gagcacctctgtttattagtcaacgatccttggcaatatgtgggtaaagtacgcaatgct
gggggcattttccttggtgaacgttcgtttgaagtgttgggtgattatgtggctgggcca
tcgcacattatgcccactggtggtacggctcgctatgcctcgccagtcaatgttgaccac
ttccgaaaagttatttcgttggttggcttgaacgaaaaagccttgcaacgattagggcca
gtcgctcagcgtttggctgaggccgaaggactgaccgcccatgcggcggctgtacgccgc
cgtttagagcaataa

DBGET integrated database retrieval system