KEGG   Herpetosiphon aurantiacus: Haur_2392Help
Entry
Haur_2392         CDS       T00614                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Haur_2392
Enzymes [BR:hau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Haur_2392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3047564..3049582)
Genome map
AA seq 672 aa AA seqDB search
MSVTLTANGLAVNGQEVPVYSGTIHYWRLERDRWDYILDQAKALGFSMIETYIPWGVHET
APGQYDWGQIDPRKDLAAFMRLCHERGIWLIARPGPLINAELTDFGFPQWILDDPAMQAR
TVLDTMHMSLAAGLHPPHQFPVPSYTSPEYLAAVGVWFDHMCQVIVPQLAPHGPIVAVQS
DNETCYMFHEQAYATDYSPSSLALYQAMLAEQYGAIEELNQAYATNYANFSEVIAPRDAD
IASRPDLVAHLDWVRYKEVHVNWIVATMADMLRERGVVDVPLFHDVAFQYRTPLDINAME
ANGHVDWVGINYYRQPQGFDGAITLVRYMAGTTRLPFIPEFGSGLWIHHALTPRPEEAEF
VTLAALMYGIKAFNFYMLVERDRWLACPITRHGDYRPEYAQLFERLMGFLQQQQWWNFQR
KPEVLVLMSYDLGRYWAATSTLHYGHVDLLGLPPALNRVELDLGFSTDLEVESDDFHPQS
WYGSLRSTLDANHIDYDLSDSHLRSSRIADYKLVFAQSVDWMSRADQQRLLQAAETGATV
WLGPTLPTLDEYFQPCTILADQLAGKRQVALGSGHLGLLSQAELGAFCAEVAAGLPVRPQ
NPQLAVTSHRHQGREILFVANPTAETINSSLDFAHPVRLTSLWGAFAGADLQQQQPISLA
AYTIAIVEVQHD
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgacgctgactgccaacggtcttgcagtcaatggtcaggaagtgccggtttat
tccggcactattcactattggcgtttagagcgcgaccgctgggactatattctcgaccaa
gctaaggcgcttgggttttcgatgatcgaaacctacattccttggggcgtgcatgaaacc
gctcccggtcaatacgattggggccaaatcgatccacgcaaagatctcgcggcctttatg
cgtttgtgccatgaacggggaatctggctcattgcgcggcctgggccattgatcaatgct
gaattgaccgactttggctttccccaatggattttggacgatccagcgatgcaagctcgc
accgtgctggataccatgcatatgagcttagcagcgggtttgcatccaccacatcaattt
cccgtgccatcgtataccagccctgaatatttggccgccgtgggcgtttggttcgaccac
atgtgccaagtgattgtgccgcaacttgcgccgcatgggccaattgtcgcggtgcaaagc
gataatgaaacctgctatatgtttcatgagcaagcttatgcgaccgattacagcccttcg
tcgttggccttgtatcaagcaatgttggctgagcaatatggcgcaatcgaagaattgaat
caagcctatgcgaccaactatgccaatttcagcgaagtgattgcgccgcgcgatgccgat
atcgccagccgccccgatttagtggctcacctcgattgggtgcgctacaaagaagtgcat
gttaattggattgtcgcgaccatggccgatatgctgcgtgagcgtggcgtggttgatgtg
ccattattccacgatgtagccttccagtatcgcacgccgctggatattaacgccatggaa
gccaacggccatgtcgattgggttgggatcaactattatcgccaaccacaaggctttgat
ggcgcgatcaccttagtgcgctatatggctggtaccacgcgcctgccgtttatccctgaa
tttggcagcggcttgtggattcaccatgcgctcacgccacggcctgaagaagcagaattt
gtaactttagcggccttgatgtatggaattaaagccttcaatttctatatgttggtcgag
cgtgatcgttggttggcctgcccaatcactcgtcatggcgattatcgaccggaatatgcg
caattgtttgagcgcttgatgggctttttgcagcagcaacaatggtggaacttccagcgc
aaacctgaagttttggtgctgatgagctatgatcttgggcgctattgggccgccacttca
accttgcactatggccatgttgatttactcggcctgccgccagcattaaatcgggtcgaa
ttggatttgggctttagcaccgatctcgaagttgaaagcgacgattttcatccgcaaagt
tggtatggctcgttgcggagcacgctcgatgccaaccatatcgactacgatttgagcgat
agccatttgcgcagctcacgaattgctgactataaattggtgtttgcccagagcgtcgat
tggatgagccgcgccgatcaacagcggttgttgcaggctgccgaaactggtgcaaccgtt
tggcttggcccgaccttgccaacccttgacgaatacttccagccctgcacaatcttggct
gatcaattggcgggcaaacgccaagttgccttgggcagtggccatttgggcttactgagc
caagccgaattaggcgcattttgtgccgaagttgcagcgggtttgcctgtacggccccaa
aaccctcaattggcggttaccagccatcgtcaccaaggccgcgaaattctgtttgtagcc
aacccaaccgctgaaacgattaactcaagcttggattttgcccatcctgtgcgcttaacc
agcttgtggggagcattcgctggcgctgatcttcaacaacagcagccgattagcctagca
gcctacacgattgcaattgtcgaggtgcagcatgattga

DBGET integrated database retrieval system