KEGG   Herpetosiphon aurantiacus: Haur_2520Help
Entry
Haur_2520         CDS       T00614                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Haur_2520
  Lipid metabolism
   00600 Sphingolipid metabolism
    Haur_2520
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Haur_2520
Enzymes [BR:hau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Haur_2520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3218561..3221338
Genome map
AA seq 925 aa AA seqDB search
MISNPPRERILFDQGWRFALGHAFDPAQDFQLDTSHFSFLAKAGYGDGAASAKFDDRAWR
LLDLPHDWCVELPFDQRGTHSHGYKAIGRKFPANSVGWYRKTFAIPADDLGRRISLEFDG
VHRDSKVWVNGFYLGNEPSGYTSFSYDISDYLNYGGQNVVVVRADATTEEGWFYEGAGIY
RHVWLSKTAQVHVARYGTFVTSEIHEASATLTIQTTVINESQHPIEFSLLETISDPAANN
VLQAQSANYQLAAGQSAEFSHQHTLNNPQLWDLASPHLYQLTTTVLLGEQAVDSYQTTFG
IRSIRFDPDQGFFLNGRSVKLVGSNQHQDHAGVGTAIPDSLQEYRIKRLQEFNHNAIRTS
HNPPTPEFLAACDRLGMLVLNENRLMGTNAEHLRHVEQLIKRDRNHPSVILWSLGNEEWA
IEGTIIGARISSTMQNFARQFDHTRLFTIACSGGWDTGIGMVTDVVGYNYIFHGDIDAHH
AKFPWQSGVGTEESNTYGTRGIYQTDASRGHLAPSPSGDGYADTEFGWQFYVKRPFLAGL
FYWTGFDYRGEPTPFEWPAVASQFGFFDLCGFPKDIAYYTKAWWGQQPVLHIGYHWDWPN
DLDRVKSFPIYSNCQEVELWLNGQSLGRRPIPENGHQQWEVAYQPGELLARGYNNGVEVL
SASLRTSQAASQIQLVLDYGQLQQTGDLAVVTLQVCDDHGQIVPTANQLLDLQLTGSAKI
LGVGNGDPASHEPEQYHASYQLCPIQINAEQTVAELSTGLERALGAETQVWQPAFLHHND
DQQANPQAYILLRGSFELPQYSAASSIRLFSKSIAHDYSVYINGQLIISDIALEQGDQAL
ELSHELVHPGQNEYLVTGRWIKKVNPWTFPNREPGVVQVIEPAAAWQRRAFNGLAQVIVQ
HTGGDQPISLSASNPELGTATLKFD
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgattagcaacccaccccgcgaacgaattctgtttgatcaaggctggcgttttgccctc
ggccatgccttcgaccccgcccaagattttcagctggatacaagtcatttttcgtttctg
gccaaggctggctatggcgacggcgcagcctcagccaagttcgacgatcgggcttggcgt
ttgctcgatctaccccatgattggtgtgttgaattgcccttcgatcaacgcggaactcac
agccatggctacaaagcaattggccgtaagtttcccgccaatagcgttggttggtatcgc
aaaacctttgcaattcccgctgacgatcttgggagacgcatcagcctcgaattcgatggg
gtgcatcgcgattctaaagtttgggtcaatggcttttatctaggcaacgagccaagcggc
tacaccagttttagctacgatatcagcgattatctgaattatggcggccaaaacgtggtg
gtagtacgcgccgatgccaccaccgaagaaggctggttttatgaaggcgctggcatttat
cgccacgtttggttgagcaaaacggctcaagtccatgtcgcccgctatggcacattcgtc
actagcgaaattcatgaagctagcgccacgctcacaattcaaacaacggttattaacgaa
agccaacatccaatcgaatttagcttgctggaaacaatcagcgatccggctgccaataat
gtgctgcaagcccaaagtgccaattatcagctggcggcaggccaaagtgctgaattcagc
caccagcacacgctcaacaatccgcaactctgggatcttgctagcccacatttgtatcaa
ctaaccaccactgtgctgcttggtgagcaggcagtagatagctatcaaacaacctttggc
attcgcagcattcgctttgatcctgatcagggctttttcttgaatgggcgttcggtcaaa
ttggttggcagcaaccagcatcaagatcacgcgggagttggcacggctattcccgatagc
ttgcaagaatatcgcatcaaacgcttgcaggaattcaatcataatgcgattcggacttcg
cacaacccgccaacccccgaattcctcgctgcatgcgatcgtttgggaatgttggtgctg
aatgaaaatcgcttgatgggaacaaatgctgagcatttacgccatgttgagcagctgatc
aagcgtgatcggaatcatccttcggtgattttgtggtcgttgggcaacgaagaatgggcg
atcgagggtacgatcatcggcgcacgcatctccagcaccatgcaaaattttgcccgtcaa
ttcgatcatacacgccttttcacaatcgcttgtagcggcggctgggatactggtattgga
atggtgaccgatgtggttggctataattatatctttcacggcgatattgatgcccatcat
gcgaaattcccatggcaatcgggcgttggaacagaggaaagtaatacctacggtacacgc
gggatctaccaaaccgatgccagtcgtgggcatttagcgccttctcccagtggtgatggc
tacgccgatacggagttcggctggcaattttatgtcaaacgaccattcttggctgggtta
ttctattggactggctttgattatcggggcgagccaacgccctttgaatggccagcggtc
gccagtcaatttggctttttcgatttgtgcggcttccccaaagatattgcctattacacc
aaggcttggtggggccagcaaccagtcttgcacattggctatcactgggattggccgaat
gatcttgatcgagtgaaaagctttccaatttatagcaattgccaagaagttgagctatgg
ctgaatggtcagagccttggccgccgcccaattcccgaaaacggccaccaacaatgggaa
gttgcctatcaaccaggcgaattgttagcgcgtggctataacaacggggttgaagtgctc
agcgctagtttgcgcaccagccaagctgccagccaaattcaactggtgctcgattatggt
caattgcaacaaacaggtgatctagccgttgtcaccttgcaagtttgcgatgatcatggc
cagattgtgccaaccgccaatcaactactcgatctgcaattaaccggttcggccaaaatt
ttaggggtcggcaacggtgatccagctagccacgagcctgagcaatatcacgctagctat
caactttgcccaatccaaattaatgccgagcaaaccgtggccgagttgagcacaggtttg
gagcgagcgctaggagccgaaacccaagtttggcaaccagcattcttgcatcacaacgac
gatcaacaggctaatcctcaggcctatattctgttgcgtggcagcttcgagctaccacag
tacagcgctgccagcagcattcgcttgttcagcaaaagcatagcccacgattacagcgtc
tatatcaacggccaattgatcatcagcgatattgcgcttgagcaaggcgatcaagcgctt
gaattgagccatgaactggtgcacccaggccaaaacgaatatttggtgactgggcgctgg
atcaaaaaagtcaatccttggacgttccccaatcgtgagcctggcgtggtgcaggttatc
gagccagccgccgcttggcaacgccgcgccttcaacggcctagcccaagtcatcgtgcaa
catactggcggcgaccagccaattagccttagtgccagcaaccctgagctaggcacggca
acgcttaagttcgattaa

DBGET integrated database retrieval system