KEGG   Herpetosiphon aurantiacus: Haur_2593Help
Entry
Haur_2593         CDS       T00614                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_2593
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Haur_2593
  Amino acid metabolism
   00310 Lysine degradation
    Haur_2593
Enzymes [BR:hau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Haur_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3327569..3328888
Genome map
AA seq 439 aa AA seqDB search
MSVEFKMPKLGESVTEGTVGRWLKQPGESLELYEPMLEVTTDKVDTEIPSPVNGRLLEIR
VNEGDTVPVGTIIAVLEDSSSATVAAVGAPAAPAVASQASSNNGGGNSFMSPVVARLVSQ
HNLDIKQIAGTGKDGRVTKQDVERFMAQGDAAKPAPMPMPTPTAPTPAPMPVIKPSSTPA
PMPTITGSLLAKPVAYTPPATPAAPSIEPFVGDELQPLSGMRRAIAEHMVRSKATSPHVT
TVMEVDLSTIIAHRDQHKADFERQGVKLTFTPYFVQATVAGLRAVPIVNATYTDEGILLH
KSVNVGMAVAIPDGLIVPVLHNADEKSLLGLSRTVNDLAERARTRRLTADEVKDGTFTIT
NHGVSGSLFAMPIINQPQSGILGIGAIQKRPVVVTINGADAIAIRPMCYLSFTFDHRLID
GATADKFLATVKQQLEQFA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgaatttaagatgccaaagcttggtgagagcgtcaccgagggcacagttggg
cgctggctcaagcaaccaggcgagagccttgaactctatgagccaatgctcgaagttact
accgacaaagtggataccgaaattccttcgccagtcaatgggcgattgctcgaaattcgg
gtcaacgaaggcgataccgtgccagttggtacgatcattgcggtcttggaagatagtagt
agcgctacggttgccgccgttggcgcaccagccgcgcccgccgtcgccagccaagcaagc
agcaataacggcggtggcaatagctttatgtcaccagtcgtggctcgcttggtcagccag
cataacctcgatattaagcaaattgctggcactggcaaagatggccgcgtgaccaagcaa
gatgttgagcgctttatggctcagggtgatgctgccaaaccagcaccgatgccaatgcca
acgccaaccgcgccaaccccagcgccgatgcccgtcatcaaaccaagctcaacgccagca
ccaatgccgacgattactggcagtttgctggccaaaccagtggcttatactccgccagcc
acgccagccgcgccgagcatcgagccatttgttggtgatgaattacaaccgttgagtggt
atgcgccgcgcaatcgctgagcatatggtgcgctcaaaagcaacctcgccacacgttacc
acagtgatggaagttgatctcagcacaattatcgcgcatcgtgaccaacataaggccgat
ttcgagcggcaaggggttaaattaacctttacgccctattttgtgcaggcaactgtagca
ggcttacgagcagtgccaattgtcaatgccacctataccgatgaaggcattttgctgcat
aaatcggttaacgttggcatggccgtggccattcccgatggcctgatcgtgccagtgctg
cataacgccgatgaaaagagcttgctggggctttcgcgcacagtcaacgatttggccgaa
cgcgcccgcacgcgccgcctaaccgccgatgaagtgaaagacggcacctttacaattaca
aatcacggcgtaagtggctcgctatttgccatgccaatcatcaaccagcctcaatcgggc
attttggggattggtgcaatccaaaagcggcctgtggtcgtgacgatcaacggagccgat
gcaatcgcgattcggccaatgtgctacctcagttttacgtttgaccatcgcttgatcgac
ggcgcaaccgccgataaattcttggcaaccgtcaagcaacaacttgagcaatttgcctag

DBGET integrated database retrieval system