KEGG   Herpetosiphon aurantiacus: Haur_2593Help
Entry
Haur_2593         CDS       T00614                                 

Definition
(RefSeq) dehydrogenase catalytic domain-containing protein
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_2593
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Haur_2593
  Amino acid metabolism
   00310 Lysine degradation
    Haur_2593
Enzymes [BR:hau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Haur_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3327569..3328888
Genome map
AA seq 439 aa AA seqDB search
MSVEFKMPKLGESVTEGTVGRWLKQPGESLELYEPMLEVTTDKVDTEIPSPVNGRLLEIR
VNEGDTVPVGTIIAVLEDSSSATVAAVGAPAAPAVASQASSNNGGGNSFMSPVVARLVSQ
HNLDIKQIAGTGKDGRVTKQDVERFMAQGDAAKPAPMPMPTPTAPTPAPMPVIKPSSTPA
PMPTITGSLLAKPVAYTPPATPAAPSIEPFVGDELQPLSGMRRAIAEHMVRSKATSPHVT
TVMEVDLSTIIAHRDQHKADFERQGVKLTFTPYFVQATVAGLRAVPIVNATYTDEGILLH
KSVNVGMAVAIPDGLIVPVLHNADEKSLLGLSRTVNDLAERARTRRLTADEVKDGTFTIT
NHGVSGSLFAMPIINQPQSGILGIGAIQKRPVVVTINGADAIAIRPMCYLSFTFDHRLID
GATADKFLATVKQQLEQFA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgaatttaagatgccaaagcttggtgagagcgtcaccgagggcacagttggg
cgctggctcaagcaaccaggcgagagccttgaactctatgagccaatgctcgaagttact
accgacaaagtggataccgaaattccttcgccagtcaatgggcgattgctcgaaattcgg
gtcaacgaaggcgataccgtgccagttggtacgatcattgcggtcttggaagatagtagt
agcgctacggttgccgccgttggcgcaccagccgcgcccgccgtcgccagccaagcaagc
agcaataacggcggtggcaatagctttatgtcaccagtcgtggctcgcttggtcagccag
cataacctcgatattaagcaaattgctggcactggcaaagatggccgcgtgaccaagcaa
gatgttgagcgctttatggctcagggtgatgctgccaaaccagcaccgatgccaatgcca
acgccaaccgcgccaaccccagcgccgatgcccgtcatcaaaccaagctcaacgccagca
ccaatgccgacgattactggcagtttgctggccaaaccagtggcttatactccgccagcc
acgccagccgcgccgagcatcgagccatttgttggtgatgaattacaaccgttgagtggt
atgcgccgcgcaatcgctgagcatatggtgcgctcaaaagcaacctcgccacacgttacc
acagtgatggaagttgatctcagcacaattatcgcgcatcgtgaccaacataaggccgat
ttcgagcggcaaggggttaaattaacctttacgccctattttgtgcaggcaactgtagca
ggcttacgagcagtgccaattgtcaatgccacctataccgatgaaggcattttgctgcat
aaatcggttaacgttggcatggccgtggccattcccgatggcctgatcgtgccagtgctg
cataacgccgatgaaaagagcttgctggggctttcgcgcacagtcaacgatttggccgaa
cgcgcccgcacgcgccgcctaaccgccgatgaagtgaaagacggcacctttacaattaca
aatcacggcgtaagtggctcgctatttgccatgccaatcatcaaccagcctcaatcgggc
attttggggattggtgcaatccaaaagcggcctgtggtcgtgacgatcaacggagccgat
gcaatcgcgattcggccaatgtgctacctcagttttacgtttgaccatcgcttgatcgac
ggcgcaaccgccgataaattcttggcaaccgtcaagcaacaacttgagcaatttgcctag

DBGET integrated database retrieval system