KEGG   Herpetosiphon aurantiacus: Haur_2912Help
Entry
Haur_2912         CDS       T00614                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hau00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3684982..3686541
Genome map
AA seq 519 aa AA seqDB search
MTFERAAGILLHPTSLHGRYGIGDLGSEAYQFVDWLQAAGARLWQILPLGPTGYGDSPYQ
CFSAFAGNHMLISPDYLARINLLAEWDLEQLTHLPAEAVDFGAVIPAKLQLLRTAFENFK
AQADDRGFRAFCVAEQAWLDDYALFMACKAAHGGASWTTWDQAIALHEPAAISEWGNKLA
DDVQFHKFLQWAFFSQWDALKHYANERDIKIVGDIPIFVAHDSADVWANRSLFLLHPDGN
PVDIAGVPPDYFSATGQRWGNPLYRWDVMAQDGYQWWQQRISASLRTVDIVRVDHFRGFA
GYWAVPASEETAVNGEWRRGPGADFFQAISHAFGSLPLIAEDLGMITPDVYQLRDQFALP
GMRILQFAFTSGAFQSNFLPHTYVQNTVAYTGSHDNDTSRGWYTSAGPEEQHRARTYLYC
GEDAIVWTMIRTLYASVADTVIIPMQDALDLGSEARMNRPGYTGGNWAWRIKPDQLSYDL
ARSLYGLAEVYGRLAQPAISNELDPNAPPYFDLQETSEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgaacgtgctgcggggattcttctgcaccccacgtcgttgcatggtcgctat
ggaattggcgatcttggcagcgaggcttaccaatttgtggattggctacaagctgctggc
gcacggctatggcaaattttgccactcggcccaactggctatggcgattcgccctatcaa
tgtttttcggcgtttgctggcaaccatatgctgatcagccccgattatttggctcggatc
aatttgctagccgaatgggacttggaacaactcacccatttgccagccgaagctgtcgat
tttggcgcggtaattccggccaaattgcagcttttgcgcaccgcctttgaaaatttcaag
gctcaagccgatgatcgtggttttcgcgcgttttgtgttgccgaacaagcgtggctcgac
gattatgccttgtttatggcttgtaaagcagctcatggcggcgcttcttggacgacatgg
gatcaggcaattgctttgcatgaaccagcggcaatcagcgaatggggcaacaaattagct
gatgatgtgcagtttcataagtttttgcagtgggcctttttcagccaatgggatgccttg
aagcactatgccaacgagcgcgatatcaaaattgttggcgatattccaatttttgtagct
cacgatagcgccgatgtttgggctaatcgcagcctgtttttgctgcatcccgatggcaat
ccggttgatattgcgggtgtgccaccagattatttttcggcgaccggccagcgctggggc
aacccactctatcgttgggatgtgatggcccaagatggctatcaatggtggcaacagcga
attagtgccagtttgcgcaccgtcgatatcgtgcgggttgatcacttccgtggctttgcc
ggctattgggctgtgccagcaagcgaagaaaccgctgttaatggcgagtggcgacgtggc
ccaggcgcagatttcttccaagcaattagccatgcttttggcagtttgccgttgattgcc
gaagatttaggcatgatcacgcctgatgtgtatcaattgcgcgaccaatttgccttgcct
ggcatgcggattttgcaatttgccttcacatcgggagccttccaatcgaacttcttgccc
catacctatgtgcaaaatacggttgcctacactggctcgcacgataacgatacctcgcgc
ggctggtacacgagtgctgggccagaagaacagcatcgtgctcgtacctatttgtattgt
ggcgaagacgcgattgtgtggacgatgattcgcaccttgtatgcctcagttgccgatacg
gtgattatccccatgcaagatgcgcttgatctgggcagcgaagcccgtatgaatcggcct
ggctacactggtggtaattgggcatggcgcatcaagcccgaccagctatcctatgattta
gcccgttcgctttatgggctggccgaagtgtatgggcgcttggctcagccagcgatcagc
aatgagcttgatcccaatgctccgccctattttgacctacaagaaaccagcgaactatga

DBGET integrated database retrieval system