KEGG   Herpetosiphon aurantiacus: Haur_3097Help
Entry
Haur_3097         CDS       T00614                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hau00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3905719..3906813)
Genome map
AA seq 364 aa AA seqDB search
MQPYIRPTYPFSALVGQPRLKQALVLNAVNPRIGGVLIRGEKGTAKSTAVRALAHLLPLI
TVVADCPYSCPPDQLDRMCGSCRGRLQAGEDLPLQQRTTRLVELPVSASEDRLVGSLDLE
HALVEGQRRFEPGLLAQVNRGLLYVDEVNLLDDHLVDILLDAAAMGINTVEREGISISHP
ARFILVGTMNPEEGELRPQLLDRFGLVVEIGGLKNVRERVDVIQRRMEYDADPEQFVQRW
SSNEHHLTEEIAAAKKLLPQVQISEQDMSAVAMLSLELGVDGHRADLAILETARTHAALE
GRTTISLEDIRVAAQLALPHRMRRQPFAEVRLDEQQLSDVLNKAAQERQRGNEETAGRDE
LKKA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccatatattcgaccaacctacccatttagtgcgcttgttggtcagcctcgcttg
aagcaagcactggtgcttaatgcggtcaatcctcgaatcggcggtgtgctcattcgtggc
gaaaaaggcactgctaaatcgacggctgtacgggcgttggcacatttgctgccattaatc
acggtggtagccgattgcccctatagctgcccgccagatcagcttgatcgtatgtgtggt
tcatgtcgcggtcgtttgcaagctggcgaagatttaccgttgcaacaacggacaacccgt
ttggtcgaattacctgtcagtgcctcggaagatcgtttggttggctcgcttgacctcgaa
catgctttggtcgaaggtcaacgccgtttcgagcctggcctattagctcaagttaatcgt
ggcttgctatatgtcgatgaagtgaatcttttggatgatcacttggttgatattttgctc
gatgctgcggcaatgggcatcaacacggtcgaacgcgagggcatttcgatttcacaccca
gctcgctttattttggttggcaccatgaaccccgaagaaggcgaactccgacctcaattg
cttgatcgctttggcttggtggttgaaattggtggcttgaaaaatgtgcgcgaacgggtt
gatgtgattcaacggcgcatggaatacgatgctgatcctgagcaatttgtgcaacgctgg
agcagcaacgagcatcatttgactgaagaaattgcggcggccaaaaaactcttgccccag
gtacaaatttctgagcaagatatgtcagcggtggcaatgctctcgctcgaattgggcgtt
gatggtcaccgtgccgacttggcaattctcgaaacggcgcgaactcatgccgccttagag
ggtcgcactacgatttcgctcgaagatattcgggtcgcagctcaattggccttgcctcac
cgcatgcgtcgccaaccgtttgccgaagtgcggcttgatgagcagcaactcagcgatgtg
ctgaataaggcggctcaagagcgccaacgcggcaacgaagagacagcggggcgtgacgag
ctaaaaaaagcttag

DBGET integrated database retrieval system