KEGG   Herpetosiphon aurantiacus: Haur_3166Help
Entry
Haur_3166         CDS       T00614                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hau00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3998559..3999815
Genome map
AA seq 418 aa AA seqDB search
MPEFAYNIRQYYPQQRQELLQMIAQIETYPNAAERVLTKANLIMLHCDQVDPHTAMIVKQ
ELLALDGDALVSPHVYLGQSTQPTNLLAWANERSWRALCGKFQAIPLPALQALAQQIGAL
LLHNQARGSLKLGATQWDWGRKTLVMGIVNVTPDSFSNDGLLEVGTSQIQQQALEFAAAG
ADILDVGGESTRPGASSVSIAQEIARVVPAIQAIRHVCQLPISIDSYKAEVVAAALEAGA
NVVNDIWGLRQADGSWNTALAQLVAQANVPIILMHNRVSTVEQFAHGTNYAASDYGDIIG
EVCAELRQSIDFALQAGIANDLIVLDPGIGFGKSPEQNLQVLRQLRTIASLGYPLLVGTS
RKSMIGITLNRPVDQRLWGTAATVAYAIQAGADIVRVHDVAAMVDVCRMTDALVRHEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatttgcctataacatccgtcaatattatcctcagcaacgccaagaactgttg
cagatgatcgcccaaattgaaacctatcccaatgctgctgagcgcgtattgaccaaagcc
aacttgattatgctgcattgcgatcaggttgatccacatacggccatgattgtgaagcaa
gaattattggcgctcgatggcgatgccttggttagcccacacgtctatctgggccaaagc
acgcagccaaccaatctgctggcgtgggccaatgaacgctcgtggcgagccttatgtggc
aagtttcaagcgattcctttacctgccttgcaagccttagcccaacaaattggcgcgttg
ctgttgcataatcaagcacgaggcagcctcaaacttggcgcaactcaatgggattggggt
cgaaaaaccttggtgatgggcattgtcaatgttacacccgattctttctctaacgatgga
ttgcttgaggtcggaaccagccagattcagcagcaagcgcttgagtttgccgcagctgga
gccgatattttggatgttggcggtgaatcgacgcggcctggagccagcagtgtcagtatc
gcacaggagattgcgcgggttgtgccagcgattcaagcgattcgtcacgtttgccaattg
ccaatttcgattgatagctacaaagctgaggttgtggcggctgcgcttgaagctggtgca
aatgtggttaatgatatttggggtttgcgccaagccgatggtagttggaatacggcactg
gcgcagttggtggcacaagcaaacgtgccaattattttgatgcacaatcgagtcagcacg
gttgagcaatttgcccatggcacaaattacgctgctagcgactatggcgatattatcggc
gaagtttgtgccgaattacgccaaagcatcgatttcgccctgcaagcgggcattgccaac
gatttaattgtgcttgatccaggcattggtttcggcaaaagccctgaacaaaatctacaa
gtattacgtcaactacggacaattgcaagcttaggctacccgttgttggttggcactagc
cgaaaatccatgattgggataacattaaaccgacctgttgatcaacgcctgtggggcaca
gccgccaccgtggcctatgcaattcaggcaggagccgatattgtgcgggtgcacgatgtt
gcggcaatggtcgatgtttgtcgaatgaccgacgctttagttcgtcacgaaggatag

DBGET integrated database retrieval system