KEGG   Herpetosiphon aurantiacus: Haur_3188Help
Entry
Haur_3188         CDS       T00614                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_3188
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_3188
   00052 Galactose metabolism
    Haur_3188
   00500 Starch and sucrose metabolism
    Haur_3188
   00520 Amino sugar and nucleotide sugar metabolism
    Haur_3188
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Haur_3188
   00524 Butirosin and neomycin biosynthesis
    Haur_3188
Enzymes [BR:hau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Haur_3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4033255..4034211
Genome map
AA seq 318 aa AA seqDB search
MAFAIGIDLGGTHLRAALVDRDGEILAHERIRTEAHEGAEAVVGRITQLINAMIAAANGA
TIVGAGIAAPGPLNPFTGTVITMPNLPGWENFPIRDRIAAQVPFPVVLGNDANLAAVGEW
LFGGGRGMQNMIYVTISTGVGGGVICDGRLLLGHNGFAAEVGHMVLDPHGFAPATATPAG
SWEALASGTFLAYHAAEAMRAGTATVLNQLTTPDAVTTHHLDLAAQQGDELAIRLIENAG
FWCGIAFVNLLHMFSPEAIFVGGGVSNLGDRLLNPARAEITKRALPGYRNVPIHQTKMGD
NLGVLGAAAYAFSSIQQA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgcaatcgggattgatctcgggggcacgcatttacgtgcggccttagttgac
cgagatggtgaaattcttgctcatgaacggattcgcaccgaagcgcatgaaggtgctgaa
gcagttgttggtcggattactcaattaattaacgccatgatcgctgcggcgaatggtgca
acaattgtcggcgctggcatcgccgcacctggcccactcaacccctttaccggtacggtc
attaccatgcccaacttgccaggttgggagaacttccccatccgcgatcgaatcgccgcc
caagttccgtttccagtcgtgctcggcaatgatgccaatttggctgctgtcggcgaatgg
ttattcggcggtggtcgtggcatgcaaaatatgatttacgtcacgatcagcacgggcgtt
ggtggtggggtcatttgtgatggtcggttgttgctcggtcacaatggctttgccgccgaa
gttggtcacatggtgctcgacccgcatggctttgcacccgccacggccaccccagctggt
tcgtgggaagcgctcgcatcaggcacatttttggcctaccacgctgccgaagcgatgcga
gcaggcactgccaccgtacttaatcaattaaccactcccgatgccgtcaccacccatcat
ttagatctggcggcgcaacaaggcgatgagttggcaattcgcttaatcgaaaatgctggc
ttttggtgtgggattgccttcgtcaatttgctgcatatgttcagccctgaagcgattttc
gtgggcggcggggtttccaacttaggcgatcgtttgctcaacccagctcgcgccgaaatt
accaaacgcgccttgcccggctatcgcaatgtgccaattcatcaaaccaagatgggcgat
aatctaggggtgcttggcgctgctgcctatgcatttagctcaatccaacaagcctaa

DBGET integrated database retrieval system