KEGG   Herpetosiphon aurantiacus: Haur_3188Help
Entry
Haur_3188         CDS       T00614                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00010  Glycolysis / Gluconeogenesis
hau00052  Galactose metabolism
hau00500  Starch and sucrose metabolism
hau00520  Amino sugar and nucleotide sugar metabolism
hau00521  Streptomycin biosynthesis
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
hau01120  Microbial metabolism in diverse environments
hau01130  Biosynthesis of antibiotics
hau01200  Carbon metabolism
Module
hau_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_3188
   00052 Galactose metabolism
    Haur_3188
   00500 Starch and sucrose metabolism
    Haur_3188
   00520 Amino sugar and nucleotide sugar metabolism
    Haur_3188
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Haur_3188
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Haur_3188
Enzymes [BR:hau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Haur_3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N DEDD_Tnp_IS110 Glucokinase Hydant_A_N DUF4445
Motif
Other DBs
NCBI-ProteinID: ABX05825
JGI: Haur3188
UniProt: A9B6V7
Position
4033255..4034211
Genome map
AA seq 318 aa AA seqDB search
MAFAIGIDLGGTHLRAALVDRDGEILAHERIRTEAHEGAEAVVGRITQLINAMIAAANGA
TIVGAGIAAPGPLNPFTGTVITMPNLPGWENFPIRDRIAAQVPFPVVLGNDANLAAVGEW
LFGGGRGMQNMIYVTISTGVGGGVICDGRLLLGHNGFAAEVGHMVLDPHGFAPATATPAG
SWEALASGTFLAYHAAEAMRAGTATVLNQLTTPDAVTTHHLDLAAQQGDELAIRLIENAG
FWCGIAFVNLLHMFSPEAIFVGGGVSNLGDRLLNPARAEITKRALPGYRNVPIHQTKMGD
NLGVLGAAAYAFSSIQQA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgcaatcgggattgatctcgggggcacgcatttacgtgcggccttagttgac
cgagatggtgaaattcttgctcatgaacggattcgcaccgaagcgcatgaaggtgctgaa
gcagttgttggtcggattactcaattaattaacgccatgatcgctgcggcgaatggtgca
acaattgtcggcgctggcatcgccgcacctggcccactcaacccctttaccggtacggtc
attaccatgcccaacttgccaggttgggagaacttccccatccgcgatcgaatcgccgcc
caagttccgtttccagtcgtgctcggcaatgatgccaatttggctgctgtcggcgaatgg
ttattcggcggtggtcgtggcatgcaaaatatgatttacgtcacgatcagcacgggcgtt
ggtggtggggtcatttgtgatggtcggttgttgctcggtcacaatggctttgccgccgaa
gttggtcacatggtgctcgacccgcatggctttgcacccgccacggccaccccagctggt
tcgtgggaagcgctcgcatcaggcacatttttggcctaccacgctgccgaagcgatgcga
gcaggcactgccaccgtacttaatcaattaaccactcccgatgccgtcaccacccatcat
ttagatctggcggcgcaacaaggcgatgagttggcaattcgcttaatcgaaaatgctggc
ttttggtgtgggattgccttcgtcaatttgctgcatatgttcagccctgaagcgattttc
gtgggcggcggggtttccaacttaggcgatcgtttgctcaacccagctcgcgccgaaatt
accaaacgcgccttgcccggctatcgcaatgtgccaattcatcaaaccaagatgggcgat
aatctaggggtgcttggcgctgctgcctatgcatttagctcaatccaacaagcctaa

DBGET integrated database retrieval system