KEGG   Herpetosiphon aurantiacus: Haur_3550Help
Entry
Haur_3550         CDS       T00614                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Haur_3550
Enzymes [BR:hau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Haur_3550
Exosome [BR:hau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Haur_3550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4466864..4467871
Genome map
AA seq 335 aa AA seqDB search
MSMLESVPTPNRRLRRGRRNATLRRMVRETQLTVDNLIAPLFIVEGQNIRKPISSMPGQF
QLSLDQLGTEIDELVAAQIPAVLLFGIPLHKDAQGSSAWDANGPVPSAIRAIKQQAPHLV
VIADVCMCEYTDHGHCGILTSGEPETITVDNDPTLELLARASVAYAEAGADVVAPSAMMD
GQIAAIRYGLDQAGYHDTIILSYAAKFASAFYGPFREAAESTPQFGDRRSYQMDAANARE
AIAETALDVAEGADWLMVKPAGAYLDIIRAVYEEFDLPLAAYQVSGEYAMIKAAAANGWI
DEQRVALESLLAIRRAGASMIITYYAKAAAQWLKA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgctcgaaagcgtgccaacgcccaatcgtcgtttgcggcgcggacggcgcaac
gccacattacggcgcatggtacgtgaaactcaattaactgttgataatctaattgcccca
ttatttattgttgaaggccagaatattcgcaagccaattagctcgatgcctggtcaattt
caactttcgctcgatcagctcggcactgagattgatgaactggttgcggcgcaaattcca
gcagtgctgctctttggtattcccttgcataaagatgctcaaggtagctcagcttgggat
gcgaatggccctgtgcctagcgcaattcgggcaattaaacagcaagcaccacatttggtg
gtaattgccgatgtttgtatgtgcgaatataccgaccacggccattgtggcattttaacc
agcggtgagccagaaacaatcaccgttgataatgacccaaccttggaattattagcccgt
gcttcggtggcttatgccgaggctggcgctgatgtggttgctcccagcgccatgatggat
ggccaaattgccgcaattcgctatggccttgatcaagcaggctaccacgacacaattatt
ttgtcgtatgcagctaaatttgcctcggctttttatggcccgttccgcgaagctgctgaa
tcaacaccccaatttggcgaccgccgctcgtaccaaatggatgcggccaacgcccgcgag
gcgattgccgaaaccgcgctcgatgtcgccgagggagcagattggctgatggtcaagcca
gctggggcttatttggatattattcgggcagtttacgaagaatttgatctaccactagca
gcctatcaagtgagcggcgaatatgccatgatcaaggctgctgctgccaacggctggatc
gatgagcaacgggtggcacttgaaagcttgctggcaattcgccgagcaggcgcaagtatg
atcataacctattatgccaaggcggcggcgcagtggttgaaagcctag

DBGET integrated database retrieval system