KEGG   Herpetosiphon aurantiacus: Haur_3590Help
Entry
Haur_3590         CDS       T00614                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00030  Pentose phosphate pathway
hau01100  Metabolic pathways
hau01120  Microbial metabolism in diverse environments
hau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Haur_3590
Enzymes [BR:hau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Haur_3590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABX06226
JGI: Haur3590
UniProt: A9B589
Position
complement(4518715..4520520)
Genome map
AA seq 601 aa AA seqDB search
MAFIGRALRINLDTASTSTFDIPSPIRELYLGGRGLTAGLMYHFVPPDTAVRSPDNPLLL
APGVLAGTPAYATGGFVATTRSPLTGNLIHSWAVGDWGAALKRAGFDAVWVVGQATAWLY
AVIDNGQAELYPANHLNGLDTQQINDALMAEHGADARVLTLGQAGEKMLPYAALVAEGRY
LAEPAGTGMVMALKRLKAIVVRGTRMVKPADTANFLSSFKPITERIDRDPLATAIRDYGS
SYYVDLAANHGAITGRNGQDPEPSVMPTTGDYAGEIYDRGCPRCPLPCYHDFATTNQPRP
EIEAIVGFGARCGLQSPAAIIEANQRCLRYGLDPNATANAIAFLMECRQRELTRQYDLQW
GDEAAILAAIDAIATKQGIGGLLSLGVYEMSQVFYGSEQFAPLANNLTISPLDPRAAQGW
ALHLATSSIGGDARGAMPWYEWLDTIPQWLKGNDDHQPNVVNGKPERLIWHERFVAGLDS
AGICRRLAALAYQITPKELATILSADIGKSVSPTDLAKVGERIITVERLLALQWGHSDDL
STRWQQQPLTSGIAANQIPTLDTLLTKYYALHGWDSDGIPTNARLAELSIPEPDSRPWVT
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttatcgggcgtgcgttacgcattaacctcgacacagccagtacttccacgttt
gacatcccatcgccaattcgcgagctatatttgggtggacgtgggctgacagcgggcttg
atgtatcattttgttccccccgatacagcagttcgctctcccgataatccgttgctgttg
gctcctggggtgttggctggcactccggcctatgctactggcggctttgtggctaccact
cgttcgcccttgactggcaatttgattcatagttgggcggtcggcgattggggcgcggcg
ctcaaacgcgctggttttgatgcggtttgggtggttggtcaggcaactgcttggctctac
gccgtgatcgataatggccaagctgaactctaccccgcgaatcatctcaatggccttgat
acccagcaaattaacgatgccctgatggccgagcacggcgctgatgcacgagttttgacg
cttggtcaggctggcgaaaagatgttgccctatgcggctttggtggccgaaggccgctac
ttggccgagccggctggcacgggcatggtgatggccttgaaacggctcaaggcaattgtg
gtgcgcggcacacgtatggtcaagcctgccgataccgccaactttctctcatcgtttaag
ccaattaccgagcgcatcgaccgcgacccattggcaaccgcgattcgcgattatggttca
agctactatgttgatttagccgctaaccatggggccatcaccggacgcaatggccaagat
cctgagccaagcgtgatgccaaccactggcgattatgctggcgagatttatgatcgtggt
tgcccacgctgcccactgccctgctaccatgattttgctaccaccaaccaacctcgcccc
gaaattgaggcgattgtgggttttggggcacgctgcggtttacaatcaccagcagcaatt
atcgaagccaaccaacgctgcctgcgctatgggcttgatcccaatgcaactgccaatgca
attgcctttttgatggaatgtcgccagcgtgaattgacccgccaatacgatttgcaatgg
ggcgatgaagcggcgattttggcggcgatcgatgcgattgccaccaaacaaggcattgga
ggcttgctctcgttgggtgtatacgagatgagccaagtcttttacggcagcgagcaattt
gccccgctggccaataatttgacgatcagcccacttgacccacgcgctgcccaaggttgg
gccttgcacttggcgaccagttcaattggtggcgatgcacgaggagctatgccttggtat
gagtggcttgataccattccccaatggctcaaaggcaacgacgaccatcaaccaaacgtg
gtcaatggcaagcctgaacgcctgatttggcatgaacgctttgtcgctggcctcgatagc
gctggaatttgtcggcgcttggcggccttggcctaccaaattacccccaaagaactggcg
acaattctaagtgccgatattggcaagagcgtttcgccgaccgatttagccaaagttggc
gagcgaattattacggtcgagcggctgctggccttgcaatggggccatagcgacgacctc
agcacccgctggcaacaacaaccattgaccagcggtattgccgccaatcaaattcccacc
cttgacacactgctaacgaaatattatgctctgcatggatgggacagtgatgggattccc
acaaatgcccgtctcgctgagctaagtattcccgaacccgattcccgaccatgggtgacg
gagtag

DBGET integrated database retrieval system