KEGG   Herpetosiphon aurantiacus: Haur_3613Help
Entry
Haur_3613         CDS       T00614                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Haur_3613
Enzymes [BR:hau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Haur_3613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4541841..4544000
Genome map
AA seq 719 aa AA seqDB search
MDQLTGNLERITYRSDETGYTVARLKAQGQRSVITIVGRLPDVQVGEQLQLEGQWIEHRT
HGRQFEVASYQTARPTGNESIVRYLASGLLPGIGPVNAQRIADTFGEATLDVLDTMPERL
REVKGLGTKKIAAIIVAWQEQRAIKALLELGQAVGLTTGLALRIFRHYGEQASQIVQHDP
YRLALEIEGIGFPTADHIAQALGVARDAPSRVIAGLRYTLSMVANTEGHCALPQIELIAQ
TQTILELPHELIAEQLAVATESVLLVLDGDLVYLPAYYHAETELAHNLQRLQQLPSAIQL
RFKQQSDAIIMRQLHNASFDLSQRQAEAVLAVLRSKVVLLTGGPGTGKTTTVRAILALLQ
QVGLRTILAAPTGRAARRLAETTNHPAATIHRTLEYSGGAGNDRWGRNEHAQLVADLVVI
DETSMLDIVLAHHMVKALAPTTHLLLVGDPDQLPAVGPGAVLRDLLASNRITTVHLDTIF
RQAADSQIITNAHAINQGQLPSVNQGDFYWFPRSNPAECGAMIVDLLTTRIPRQFPQFDP
LRDIQVLAATHRGAAGVLELNSQLQAALNPPNTTRQEATIAGTLFREGDRVIQTRNNYDL
DVSNGDLGLIQTIDLEERTVSVYFDDTRNVVYQWNEFDEVALAYAISVHKAQGSEYPVVI
VPMLRYYNVLLNRPLLYTAITRARQLVILTGDWQAVEFAIAQRRSGQRITGLSQRFGMH
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggatcaactaacaggcaacctagaacgcatcacctatcgctcggatgaaacgggctat
accgtggcgcgtttgaaagcccaaggccagcgcagcgtgatcacaattgttgggcgtttg
cccgatgtgcaagttggcgaacagttgcaacttgaaggccaatggatcgagcatcgaacc
catggccgccaatttgaagttgctagctatcaaactgcccggccaactggcaacgaaagt
attgtgcgctacttggcatcgggcttattgccaggcattggtccagtcaatgcccaacgc
atcgctgatacctttggtgaagccacgctcgatgtacttgatactatgcccgaacgctta
cgcgaagtaaaaggcttaggcacgaagaaaattgccgcaattatcgtagcctggcaagaa
caacgtgcaatcaaagccttgctcgaattgggccaagccgttgggttaacgacaggttta
gccttacgcatttttcggcactatggcgagcaggctagccagattgtgcaacacgaccct
tatcgtctagccttagaaattgaaggcattggctttccgactgccgaccacattgcccaa
gctttgggcgtagcgcgagatgctcccagtcgggtgattgctggattgcgctataccctc
agcatggttgccaacaccgaaggccattgcgctctgccccaaatcgagttaatcgcgcaa
actcaaaccatcctagaattaccccatgagctgattgccgaacaattggcggtggcaacc
gaatcagtgttattggtgcttgatggcgatctagtctatttaccagcctattatcatgct
gaaaccgagttagcacataacttgcagcgcttgcaacagctccccagtgcaatccaattg
cgcttcaagcagcaaagcgatgcgattattatgcgccaattgcataatgcgagcttcgat
ttgagccaacgccaagccgaagccgtgctggccgtgctccgctccaaagtggtgttgcta
actggcgggcctggcacaggcaaaaccaccacagtccgcgcaattttggccttgctccaa
caagttgggttacgcacaattttggcggctccaaccggacgcgccgcccgtcgtctcgcc
gaaaccaccaatcatccagctgccacaattcatcgcaccctcgaatatagcggcggcgct
ggcaatgaccgctggggccgcaacgaacatgcccaactagttgccgatttagtggtcatc
gacgaaacctcaatgctcgacattgtgctggcccatcatatggtcaaggccttggctcca
accacccatttgctcttggttggcgatcctgatcagttgccagcagttgggccaggcgct
gtattgcgcgatttgttggctagcaaccgcatcacaaccgtccatttggatacgattttt
cgccaagccgctgatagccaaattatcaccaatgcccatgcaatcaatcaaggccagtta
cccagcgtcaatcaaggtgatttctattggtttccgcgcagtaacccagccgaatgcggt
gcgatgattgtggatttgttgactacccgtattccacgccaattcccgcaatttgatcct
ctgcgcgatattcaggtgttggcagcaacccatcggggcgcggcaggcgtgctcgaatta
aacagccaactgcaagcagcactcaacccgccaaacaccactcgccaagaagccacgatt
gctggcacgctctttcgcgaaggtgatcgggttattcaaacccgtaacaattatgatctc
gatgtcagcaatggcgatttaggcctgattcaaacgattgatctcgaagaacgcacggtt
agcgtttattttgacgatactcgcaacgtcgtctatcagtggaatgagtttgatgaagtg
gccttggcgtatgcaattagcgtacataaagcccaaggctcagaatatccggtggtgatt
gtgccaatgttgcgttattacaatgtgctgctcaaccgaccgttgctgtataccgccatc
actcgcgctcgtcaattggtgattctgactggcgattggcaggccgtcgaatttgcgatt
gcccaacgccgcagtgggcagcgcatcacggggttaagccaacgctttgggatgcattga

DBGET integrated database retrieval system