KEGG   Herpetosiphon aurantiacus: Haur_3784Help
Entry
Haur_3784         CDS       T00614                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hau  Herpetosiphon aurantiacus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_3784
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Haur_3784
   00650 Butanoate metabolism
    Haur_3784
  Energy metabolism
   00190 Oxidative phosphorylation
    Haur_3784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4752717..4753118
Genome map
AA seq 133 aa AA seqDB search
MVHRDVISVTSRAQKVKVEPGAGTLLWILQRLSSYGLLLFLPIHLYFTYFTKLDTPALTY
NGMRETFSAFPLWYVLNEGLLLICALFHGLNGFRNVIYDWTTNSAVRHTVNFLLIVLGIA
GAILGFWTLWALA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaccgagatgttatcagcgttacaagccgcgctcaaaaggttaaagtagaacct
ggtgcgggcacgctgttgtggattctgcaacgcctttcttcgtatggtttgttgctgttt
ttgccaatccacctgtattttacctatttcaccaagcttgatacaccagcactgacctat
aacggtatgcgcgaaaccttcagcgcatttccactgtggtatgtgctgaacgaagggctt
ttgttaatttgtgcgctgtttcatggcctcaacggctttcgcaatgtcatctacgactgg
acaaccaatagcgctgtgcgccatacggtcaactttttgttgattgtcttgggtatcgcc
ggggcaattttgggcttctggacgttgtgggctttggcataa

DBGET integrated database retrieval system