KEGG   Herpetosiphon aurantiacus: Haur_3892Help
Entry
Haur_3892         CDS       T00614                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00052  Galactose metabolism
hau00561  Glycerolipid metabolism
hau00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Haur_3892
  Lipid metabolism
   00561 Glycerolipid metabolism
    Haur_3892
   00600 Sphingolipid metabolism
    Haur_3892
Enzymes [BR:hau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Haur_3892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C Glyco_hydro_97 Raffinose_syn
Motif
Other DBs
NCBI-ProteinID: ABX06526
JGI: Haur3892
UniProt: A9AUT8
Position
4884400..4885563
Genome map
AA seq 387 aa AA seqDB search
MTTSEQPLAPTPPMGWNSWNMFGSTIHEDSVRATADVLVSSGLKDCGYNYVVIDDCWSTK
VGRDGNGDLVADPEKFPSGIKALADYVHSLGLKIGIYSDAAHLTCASYPGSFGFEEQDAQ
LWASWGIDFLKYDFCFAPTDQATAIDRYTRMGEALRKTKRQFLYSLCEWGGRSPQLWGRS
VGGHMWRVTGDIFDSWVDIWVAPHKYYGVGIDTAIDIAANLAEYAGPDAWNDLDMLVVGL
KGKGQISGGGLSFIEYQTHMSLWTIACSPLMIGCDIRNMDRDTTSLLTNREVLAVNQDSL
GIAGRRVKQTGTCEIWKKPLADGSLAVALINRGSIGSDLSLRASDIGLLDTPKSVRNLWA
QADIAEFGEAWQTRIQPHETLLLKIKA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttcagaacagcctctcgcacctacgcccccaatgggttggaactcgtggaac
atgtttggtagtacgattcatgaagattcagtccgtgccactgctgacgtgttggttagc
tcaggcctcaaggattgtggttataactatgtggtgattgatgattgctggtcaaccaaa
gttggccgcgatggcaacggcgatttggttgccgaccccgaaaaattccccagtggcatc
aaagcgctagccgattatgtgcatagccttggtttgaaaattggcatctactccgatgcg
gcgcatctgacttgcgctagttatcctggcagctttggcttcgaggagcaagatgcccaa
ttatgggcttcgtggggcatcgatttcctcaaatatgatttttgttttgcgccaaccgac
caagccactgcgatcgaccgttacacccgcatgggcgaggcgttgcgcaaaacgaagcgc
caatttctctactcgttgtgtgagtggggtggccgcagcccacagctctggggtcgctcg
gttggcgggcatatgtggcgggtcactggcgatattttcgatagctgggttgatatttgg
gttgcgccacacaaatattatggggtaggcattgatacagcgattgatattgccgccaat
ttagccgaatacgctggccctgatgcctggaacgatttggatatgctggtggttggattg
aagggcaagggtcaaatctctggcggtggcttatcattcatcgaatatcaaacccatatg
tcgttgtggacgatcgcctgctcgcccttgatgatcggctgcgatattcgcaatatggat
cgcgataccaccagtttattgactaatcgcgaagttttggccgtcaaccaagatagtttg
gggattgctgggcggcgcgtgaaacaaaccggcacgtgcgaaatttggaaaaaaccgctc
gccgatggctcgttggcggttgccttgattaatcgtggctcgatcggcagcgatttaagc
ttgcgagccagcgatattggcctgctcgatacgccgaaatcagtacgaaatttgtgggcg
caagcagatattgccgagtttggcgaggcttggcaaacccgcattcaaccccatgaaaca
ttattgctcaaaatcaaagcctaa

DBGET integrated database retrieval system