KEGG   Herpetosiphon aurantiacus: Haur_3924Help
Entry
Haur_3924         CDS       T00614                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hau  Herpetosiphon aurantiacus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Haur_3924 (recR)
DNA repair and recombination proteins [BR:hau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Haur_3924 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4917876..4918490
Genome map
AA seq 204 aa AA seqDB search
MAFGYDTITPEPVAKLIDEFNRLPGIGPKSASRLVFYLLRAKREQSERLANAIMAMKDST
IFCNRCFNITVEDPCTICTNANRNERQVCVVEEPLDVVALERTGEFKGLYHVLHGAISPV
EGINPEDLRIRELLARLRVEPIEEVILSTNPNLEGDATAAYLAREIIPLGIRVTRLARGL
PMGSDLEYADEVTLGRALQGRREM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgggtacgatacgattacaccagaaccagtcgcaaaattaattgatgaattt
aatcgcttgcctggcattgggccaaaatcggcctcgcgcttggttttttacctgctccgc
gccaaacgtgagcaatctgagcgcttggccaacgcgattatggccatgaaagatagcacg
atcttttgtaatcgctgctttaacattacggtcgaagacccttgcacaatttgcacaaat
gccaatcgcaatgagcgccaagtgtgcgtggtcgaggagccgctcgatgtggtggcctta
gaacgcacgggcgaattcaaaggcctgtatcatgtgctgcacggggcaatctcaccagtc
gaaggcatcaatcccgaagatttgcggattcgtgagttgttggctcgcttgcgggtcgag
ccaattgaagaagtgattctttcgaccaatcccaatcttgagggcgatgccactgcggcc
tatctggcccgcgagattatccctttgggtattcgggtaacgcgcttggcgcggggcttg
ccaatgggtagcgatcttgaatatgccgatgaagtaaccttggggcgagcattgcagggc
cgtcgcgaaatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system