KEGG   Herpetosiphon aurantiacus: Haur_3938Help
Entry
Haur_3938         CDS       T00614                                 

Definition
polyphosphate--glucose phosphotransferase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_3938
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_3938
   00520 Amino sugar and nucleotide sugar metabolism
    Haur_3938
Enzymes [BR:hau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Haur_3938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4933487..4934254)
Genome map
AA seq 255 aa AA seqDB search
MAILGIDIGGSGIKGALVDVAQGTMIGERLRISTPQPATPEAVAQTVQQLVQQLNWHGPI
GCTFPAIVKNGYTLSAANVDQTWIGANADQLFEQATGCPFHMLNDADAAGLAEMKYGAGK
EHNGVVMMLTFGTGIGSALFVQGLLVPNTELGHLEIRGKDAEHRASDRVREEKGWDWPKW
AEKVNEVLARIEALFSPDLLIMGGGVSKRFDKFGQYLQTKAPLVPATLQNNAGIIGAALA
ASELFEQGHQIPNAH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcaattttgggcattgatattggtggttcaggcatcaaaggggcgctggtcgatgtc
gcccaaggcacgatgattggcgagcgcctgcgcattagcacgccccaaccagcaaccccc
gaggcagttgcacaaacggttcagcaattagttcaacaattaaattggcatggcccgatt
ggttgcacctttccggcaatcgtcaaaaatggctataccctcagcgctgccaacgtcgat
caaacttggattggcgcaaatgctgatcaattgtttgagcaagcgactggttgcccgttt
catatgctcaacgatgccgatgcggcgggtttggccgaaatgaaatatggcgcgggcaaa
gaacataacggcgtggtgatgatgttgacctttggcacaggcattggcagcgctttgttc
gtccaaggtttgttggtgccaaatactgagctgggccacttagaaattcgcggcaaagat
gctgaacatcgcgcttcggatcgcgtgcgcgaggaaaaaggctgggattggccgaaatgg
gccgagaaagttaacgaggttttagctcgcatcgaagcactcttttcacccgatttgttg
attatgggtggtggggtcagtaaacgcttcgataaatttggccagtatttgcaaaccaaa
gcgccactcgttccagccacactgcaaaataacgctggaattatcggcgcggccttggcg
gctagcgaattgttcgagcagggtcaccaaattccgaatgcccactaa

DBGET integrated database retrieval system