KEGG   Herpetosiphon aurantiacus: Haur_4053Help
Entry
Haur_4053         CDS       T00614                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Haur_4053
Enzymes [BR:hau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Haur_4053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5171007..5171489
Genome map
AA seq 160 aa AA seqDB search
MTIVYLAIGSNQGDRLANLQAGLAALAPAVQLTNYSSVYETAAAYVEDQPPFLNAVVAGT
TELAPHALLALLKQIEHDCGRRPGLRYGPRPLDLDILLYGELELQTNDLIIPHLRMFERD
FVLRPLAEIAPNQVNAEQLAQATQGSVLAVVYSAKQLQGR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgtttatttagccatcggcagcaaccaaggcgatcgtttagccaacttacaa
gcgggcttagccgctttagctcccgctgtgcaactaaccaactactcaagcgtttatgaa
accgcagcggcctacgttgaagatcaaccgccgtttttgaatgcggtggttgctggcaca
accgaattagcgccacatgcgctgttagccttgctcaagcagatagagcacgattgtggc
cgccgacctggcttgcgttacggcccgcgcccgcttgatcttgatattttgttgtatggc
gagcttgaattgcaaaccaatgacttgattattccacatttgcggatgttcgagcgtgat
tttgtgttgcgacccttggccgaaatcgcccccaaccaggtcaatgctgagcaacttgcc
caagcaacccaaggcagcgttttagctgttgtctactcagccaagcaattacagggcaga
tga

DBGET integrated database retrieval system