KEGG   Herpetosiphon aurantiacus: Haur_4348Help
Entry
Haur_4348         CDS       T00614                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Haur_4348
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_4348
  Lipid metabolism
   00071 Fatty acid degradation
    Haur_4348
  Amino acid metabolism
   00350 Tyrosine metabolism
    Haur_4348
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Haur_4348
   00626 Naphthalene degradation
    Haur_4348
Enzymes [BR:hau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Haur_4348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5556427..5557584)
Genome map
AA seq 385 aa AA seqDB search
MQEFFEFRLLPRVLYKSGLVAEMGAELSSLGATKAFIVTDAGLVKSGLVEQVQQALAETV
EVVGVYSDVPPNSSVTVVEAAAAQARESGADLLVALGGGSPIDTAKAMRILITEGGNLLD
YEGINVLERRLIPMVAIPTTAGTGSEASNFAVIKDEANNVKLSFTSPYLAPELAILDPQV
TQSLPAHLAAATGMDTLTHAFETYVSTESEPMSDALALGAVEIVSNYLRDATHHGSTNEE
ARGQMLIASCMAGIAFTNSYLGAVHALAHATGGHFPLHHGLLNSIFLPHVVAFNASTVPD
RYARLARAFGINTGGRPREEVIDDLIAGLRQLASDCGLITQLRDLGIPEDSLPMLAEQAF
GDGAVYHNPVAPTVDDLLGILQAAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaattttttgagtttcgtttactgccacgggtgttgtataaatcagggttggtt
gccgaaatgggagctgaattaagctcgctgggcgcaaccaaggccttcattgtgaccgat
gctggtttggtcaagtcaggcttggtcgagcaagttcaacaagcgttggccgagacggtc
gaagtcgtcggcgtttatagcgatgttccgccaaattcctcggtgaccgtggttgaagca
gctgcggctcaagcccgcgaatcgggcgctgatctgttggtggcgcttggcggtggttca
ccaattgataccgccaaagccatgcgtattttgatcaccgagggcggcaatttactcgat
tatgaagggattaatgtgctggaacggcgcttaattccgatggtggcaattcctacgacc
gctggcactggctcggaagctagcaactttgccgtaatcaaggatgaagccaataacgtt
aagctttcatttaccagcccttaccttgcgcctgagttggcgattcttgacccgcaagta
acccaaagtttgccagcacatttggctgccgcaacgggcatggatacgctgacgcatgcc
tttgaaacctatgtctcaaccgaatctgagccaatgagtgatgccttggccttgggcgcg
gtcgagattgtttcaaattatctgcgtgacgcaacccaccatggctcgaccaatgaagaa
gctcgcggccagatgttgattgcctcgtgtatggcggggattgcctttaccaactcatat
ttgggtgcggtgcatgccttggctcacgctactggcggccatttccccttgcaccatggc
ttgctcaattcgattttcttgccgcatgtagttgcctttaatgccagcaccgtgcccgat
cgctatgcgcggttggcacgagcctttgggatcaacactggtggtcggccacgcgaggaa
gtgatcgacgatttgattgcaggtttgcgtcagttggccagcgactgcggcctgatcacc
caactgcgcgatttgggcattcctgaagattccttgccaatgttggctgaacaagccttt
ggcgatggagcggtttaccataaccctgttgcgccaactgttgatgatttactggggatt
ttgcaagcagcatggtag

DBGET integrated database retrieval system