KEGG   Herpetosiphon aurantiacus: Haur_4499Help
Entry
Haur_4499         CDS       T00614                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_4499
   01230 Biosynthesis of amino acids
    Haur_4499
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_4499
   00030 Pentose phosphate pathway
    Haur_4499
   00051 Fructose and mannose metabolism
    Haur_4499
   00052 Galactose metabolism
    Haur_4499
  Energy metabolism
   00680 Methane metabolism
    Haur_4499
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Haur_4499
Enzymes [BR:hau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Haur_4499
Protein phosphatases and associated proteins [BR:hau01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Haur_4499
Messenger RNA biogenesis [BR:hau03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Haur_4499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5759585..5760676
Genome map
AA seq 363 aa AA seqDB search
MAIRKVAILTSGGDAPGLNGVIRAFVKSAVLEHGWEVVGIEDGFEGLVGTPRLRPLGLKE
VRGLLGRGGTILGSTNKGNFGWHKNADGELVRNDASYQEFVANAKAEGIDAVVVLGGEGS
QSIAHDLGSFGLPVVGVPKTIDNDLVGTDQTFGFDTAIGVATDALDRLHTTAESHDRVMV
LEVMGRHAGWIALHAGLAGGVDAILIPEIPFDLRALAHKIGERDAFGSSFSIIIVAEGAM
PAGGEAIYQREGLLGGIGYYVANQLAELTGKDTRAVVLGHIQRGGSPTPIDRILASRYGV
GAVWAISQGRFGQLVAIQNDQLITVPLLECANKIKPVPVDGQMVRTGRSLGIVFGDEEQR
INQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggccattcgcaaagttgcaattttaaccagtggtggcgatgccccaggcttaaacggt
gttattcgggcttttgtaaaatcggcagttttagagcatggctgggaagtggtggggatt
gaagatggttttgagggtttggttggtacgccgcgcctgcggcctttaggattgaaagaa
gtgcgtgggttgctcggtcgcggcggcacgattttgggcagcaccaacaaaggtaatttt
ggttggcacaaaaatgccgatggcgagctggtgcgcaacgatgcatcctaccaagaattt
gtggccaatgccaaagctgaaggtatcgatgcagtcgtggtcttaggcggcgaaggtagt
caatcgatcgcccacgatttggggagctttggtttgccagtggttggcgtgcccaaaacg
atcgataacgatttggtgggtacagaccaaaccttcggttttgatacagcgattggggtt
gctaccgatgcgcttgatcgcttgcacaccaccgccgaaagccatgatcgggtgatggtg
ctcgaagtcatgggtcgccatgcgggctggattgccttgcacgctggcttggctggcggg
gttgatgccatcctgattcctgaaattcccttcgatttacgcgctctggcccacaaaatt
ggcgaacgtgatgcatttggttcatcgtttagcatcattatcgtggctgagggcgcaatg
ccagccggcggcgaggcaatttaccaacgcgaaggcttgctcggcgggattggctattac
gttgccaatcaattggctgaattaactggcaaagatacccgggcagtcgtgttggggcat
attcaacgtggtggctcacctacgccgatcgatcgaattttggcttcacgctatggagtt
ggcgcagtttgggcgatctctcaagggcgctttggccaactagtggcaatccaaaacgat
caattgattaccgtgccattgcttgaatgtgccaacaaaattaagcctgtgccagttgat
ggccaaatggtacgaactggccgttcgttgggcattgtgtttggcgatgaagaacaacga
attaatcaatag

DBGET integrated database retrieval system