KEGG   Herpetosiphon aurantiacus: Haur_4507Help
Entry
Haur_4507         CDS       T00614                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Haur_4507
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Haur_4507
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Haur_4507
Enzymes [BR:hau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Haur_4507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5770837..5771910
Genome map
AA seq 357 aa AA seqDB search
MSQLTTHASAVPLLERYRQFLPITAQTPIVTLHEGNTPLINVPRLAAHLGVRELWLKLES
MNPTGSFKDRGMVMAIAKALEAGSKAVVCASTGNTSAAAAAYAARMGMECVVVVPAGKIA
LGKLAQALMYGAKLLVIEGNFDQALDMVRVLAEQHPITLVNSVNPYRLEGQATAAYEICD
VLGDAPDYLALPVGNAGNISAYWMGFKRYYEAHRSESLPKILGFEATGSAAIVRGEPIAY
PETVATAIRIGNPASWQLAVNARDESEGTIDHVSDEEILAAWRDLSALEGIFCEPASAAG
VAGIRKLLAAGSIDPNGRFVAVLTGHGLKDPQLAVEQFSVPQAIPAELSAVVAALDL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctaaccacccatgcttcggcggtgccattactcgaacgctaccgccaattt
ttgccgatcactgcccaaacgccaattgtcaccttgcacgagggcaatacaccgttgatc
aatgtgccacgcttggctgcccaccttggggtgcgcgaattgtggctcaaattggaatcc
atgaatccaactggttcgttcaaggatcgcggcatggtcatggcgattgccaaagcactc
gaagctggcagcaaagccgtggtctgcgcctcaactggcaataccagtgctgccgccgct
gcctatgccgctcggatgggcatggaatgtgtagtggtcgtgcctgctggcaaaatcgcc
ttaggtaaattggctcaagctttgatgtacggagccaaactcttggtgatcgaaggcaat
ttcgaccaagccttggatatggtgcgcgtgttggccgaacaacacccaattactttggtc
aactcggttaacccctatcgtttggaaggccaagcgaccgctgcctacgaaatttgcgat
gtgctcggcgatgcacccgattatttggccttgccagttgggaatgctggcaatatttcg
gcctattggatgggcttcaaacgctattatgaagcgcatcgctcggaaagcttgcccaaa
attttgggttttgaggcaactggttcggcagcaatcgtgcgcggtgagccaattgcttat
cctgaaaccgtggcaaccgcgattcgaattggcaatccggcttcgtggcagttggcagtt
aatgctcgcgacgaatcggaaggcacgatcgatcatgttagcgatgaagaaattttggcg
gcatggcgcgatctctcggcactcgaaggtattttctgcgaaccagcttcggcagcaggg
gttgccggcattcgcaagcttttggctgctggcagcatcgatcccaatggccggtttgtg
gcagttttgactggccatggcttgaaagatccacaattggctgttgagcagttctcggtt
ccacaggcgatccctgctgaattgagcgctgtggtcgccgccttagatttgtag

DBGET integrated database retrieval system