KEGG   Herpetosiphon aurantiacus: Haur_4507Help
Entry
Haur_4507         CDS       T00614                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Haur_4507
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Haur_4507
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Haur_4507
Enzymes [BR:hau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Haur_4507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5770837..5771910
Genome map
AA seq 357 aa AA seqDB search
MSQLTTHASAVPLLERYRQFLPITAQTPIVTLHEGNTPLINVPRLAAHLGVRELWLKLES
MNPTGSFKDRGMVMAIAKALEAGSKAVVCASTGNTSAAAAAYAARMGMECVVVVPAGKIA
LGKLAQALMYGAKLLVIEGNFDQALDMVRVLAEQHPITLVNSVNPYRLEGQATAAYEICD
VLGDAPDYLALPVGNAGNISAYWMGFKRYYEAHRSESLPKILGFEATGSAAIVRGEPIAY
PETVATAIRIGNPASWQLAVNARDESEGTIDHVSDEEILAAWRDLSALEGIFCEPASAAG
VAGIRKLLAAGSIDPNGRFVAVLTGHGLKDPQLAVEQFSVPQAIPAELSAVVAALDL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctaaccacccatgcttcggcggtgccattactcgaacgctaccgccaattt
ttgccgatcactgcccaaacgccaattgtcaccttgcacgagggcaatacaccgttgatc
aatgtgccacgcttggctgcccaccttggggtgcgcgaattgtggctcaaattggaatcc
atgaatccaactggttcgttcaaggatcgcggcatggtcatggcgattgccaaagcactc
gaagctggcagcaaagccgtggtctgcgcctcaactggcaataccagtgctgccgccgct
gcctatgccgctcggatgggcatggaatgtgtagtggtcgtgcctgctggcaaaatcgcc
ttaggtaaattggctcaagctttgatgtacggagccaaactcttggtgatcgaaggcaat
ttcgaccaagccttggatatggtgcgcgtgttggccgaacaacacccaattactttggtc
aactcggttaacccctatcgtttggaaggccaagcgaccgctgcctacgaaatttgcgat
gtgctcggcgatgcacccgattatttggccttgccagttgggaatgctggcaatatttcg
gcctattggatgggcttcaaacgctattatgaagcgcatcgctcggaaagcttgcccaaa
attttgggttttgaggcaactggttcggcagcaatcgtgcgcggtgagccaattgcttat
cctgaaaccgtggcaaccgcgattcgaattggcaatccggcttcgtggcagttggcagtt
aatgctcgcgacgaatcggaaggcacgatcgatcatgttagcgatgaagaaattttggcg
gcatggcgcgatctctcggcactcgaaggtattttctgcgaaccagcttcggcagcaggg
gttgccggcattcgcaagcttttggctgctggcagcatcgatcccaatggccggtttgtg
gcagttttgactggccatggcttgaaagatccacaattggctgttgagcagttctcggtt
ccacaggcgatccctgctgaattgagcgctgtggtcgccgccttagatttgtag

DBGET integrated database retrieval system