KEGG   Herpetosiphon aurantiacus: Haur_4569Help
Entry
Haur_4569         CDS       T00614                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Haur_4569
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Haur_4569
   00640 Propanoate metabolism
    Haur_4569
   00660 C5-Branched dibasic acid metabolism
    Haur_4569
Enzymes [BR:hau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Haur_4569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5846600..5847736)
Genome map
AA seq 378 aa AA seqDB search
MKLHEYQARDIVARYGIPVTGGGVAATAEEVQKVAEQIGGPVAVKAQVHVGGRGKAGGIK
LANTPAEAFDAGKAILGMDIKGLTVEKVLVAEAITFEKEIYLGVILDRATKRVVLIASSE
GGVEIEEVAKINPDAIIKLAADPLLGLQPYQAQELAYSIGITDAKQARQFSSIATGLYRA
FVENDAELAEINPLVVLPNGQLQALDSKIVLDDSGLFRHSEVAGMRDIAGEPESEIKARE
NGLTFIKLDGNIGCMVNGAGLAMATMDVVNLFGGEPANFLDIGGGANAQKVAAALDIILD
DPNVKVVMVNIFGGITRCDEVAKGIVEAQKIIKRQVPMVVRLVGTNEAEGQRILADASLT
PASTLADAAQKAVDIAKQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacgaataccaagcccgtgatatcgtggctcgttatggcattccagtaaca
ggcggcggtgttgctgcgacggcggaagaagttcaaaaagttgccgagcaaattggcggc
ccagtggcagtcaaggcgcaagtgcatgttggcggtcggggcaaagctggcgggatcaag
ttggccaacacgccagccgaagccttcgatgctggcaaagccattttaggcatggatatc
aaaggcctgacggttgaaaaagtgctggtagccgaagcgatcacctttgaaaaagaaatt
taccttggggtgattttggatcgtgcgaccaagcgagttgtgctgattgcttcatcagag
ggtggcgttgaaatcgaagaagtcgccaaaatcaatcctgatgcaatcatcaaattggca
gctgaccccttacttggcttgcaaccctaccaagctcaagaattggcctatagcattggc
ataaccgatgctaagcaagctcgccaattttcaagcatcgcaaccggtttgtatcgggca
tttgtcgaaaacgatgctgaattagccgaaatcaaccccttggtggtgttgccaaacggc
caattgcaagccctcgactcgaaaattgtgcttgatgatagcggtttgttccgccacagc
gaagttgcgggcatgcgcgatatcgcaggcgagccagaatcagaaatcaaagctcgcgaa
aatggtctgacctttatcaagctcgatggcaatattggctgtatggtcaatggcgcaggc
ttggcaatggccaccatggacgtggtaaatctgttcggcggcgaaccagccaacttcctt
gacatcggtggtggggctaacgcccaaaaagtcgccgcagcccttgatattattcttgat
gatcccaatgttaaagttgtcatggtcaatatctttggtggcatcacccgctgcgatgaa
gttgccaaggggattgtcgaagcccaaaaaatcatcaagcgtcaagtgccaatggtcgtg
cgcttggttggcaccaacgaagccgaaggccaacgcattttggctgatgccagcttaact
ccagcttcaaccttggccgacgcagcccaaaaagctgttgatattgccaaacaataa

DBGET integrated database retrieval system