KEGG   Herpetosiphon aurantiacus: Haur_4569Help
Entry
Haur_4569         CDS       T00614                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00020  Citrate cycle (TCA cycle)
hau00640  Propanoate metabolism
hau00660  C5-Branched dibasic acid metabolism
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
hau01120  Microbial metabolism in diverse environments
hau01130  Biosynthesis of antibiotics
hau01200  Carbon metabolism
Module
hau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Haur_4569
   00640 Propanoate metabolism
    Haur_4569
   00660 C5-Branched dibasic acid metabolism
    Haur_4569
Enzymes [BR:hau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Haur_4569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 ATP-grasp GARS_A TRIC
Motif
Other DBs
NCBI-ProteinID: ABX07200
JGI: Haur4569
UniProt: A9B0I2
Position
complement(5846600..5847736)
Genome map
AA seq 378 aa AA seqDB search
MKLHEYQARDIVARYGIPVTGGGVAATAEEVQKVAEQIGGPVAVKAQVHVGGRGKAGGIK
LANTPAEAFDAGKAILGMDIKGLTVEKVLVAEAITFEKEIYLGVILDRATKRVVLIASSE
GGVEIEEVAKINPDAIIKLAADPLLGLQPYQAQELAYSIGITDAKQARQFSSIATGLYRA
FVENDAELAEINPLVVLPNGQLQALDSKIVLDDSGLFRHSEVAGMRDIAGEPESEIKARE
NGLTFIKLDGNIGCMVNGAGLAMATMDVVNLFGGEPANFLDIGGGANAQKVAAALDIILD
DPNVKVVMVNIFGGITRCDEVAKGIVEAQKIIKRQVPMVVRLVGTNEAEGQRILADASLT
PASTLADAAQKAVDIAKQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacgaataccaagcccgtgatatcgtggctcgttatggcattccagtaaca
ggcggcggtgttgctgcgacggcggaagaagttcaaaaagttgccgagcaaattggcggc
ccagtggcagtcaaggcgcaagtgcatgttggcggtcggggcaaagctggcgggatcaag
ttggccaacacgccagccgaagccttcgatgctggcaaagccattttaggcatggatatc
aaaggcctgacggttgaaaaagtgctggtagccgaagcgatcacctttgaaaaagaaatt
taccttggggtgattttggatcgtgcgaccaagcgagttgtgctgattgcttcatcagag
ggtggcgttgaaatcgaagaagtcgccaaaatcaatcctgatgcaatcatcaaattggca
gctgaccccttacttggcttgcaaccctaccaagctcaagaattggcctatagcattggc
ataaccgatgctaagcaagctcgccaattttcaagcatcgcaaccggtttgtatcgggca
tttgtcgaaaacgatgctgaattagccgaaatcaaccccttggtggtgttgccaaacggc
caattgcaagccctcgactcgaaaattgtgcttgatgatagcggtttgttccgccacagc
gaagttgcgggcatgcgcgatatcgcaggcgagccagaatcagaaatcaaagctcgcgaa
aatggtctgacctttatcaagctcgatggcaatattggctgtatggtcaatggcgcaggc
ttggcaatggccaccatggacgtggtaaatctgttcggcggcgaaccagccaacttcctt
gacatcggtggtggggctaacgcccaaaaagtcgccgcagcccttgatattattcttgat
gatcccaatgttaaagttgtcatggtcaatatctttggtggcatcacccgctgcgatgaa
gttgccaaggggattgtcgaagcccaaaaaatcatcaagcgtcaagtgccaatggtcgtg
cgcttggttggcaccaacgaagccgaaggccaacgcattttggctgatgccagcttaact
ccagcttcaaccttggccgacgcagcccaaaaagctgttgatattgccaaacaataa

DBGET integrated database retrieval system