KEGG   Herpetosiphon aurantiacus: Haur_4659Help
Entry
Haur_4659         CDS       T00614                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00860  Porphyrin and chlorophyll metabolism
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Haur_4659
Enzymes [BR:hau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Haur_4659
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Haur_4659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase DAO NAD_binding_8 Pyr_redox_2 HI0933_like NAD_binding_9 FAD_binding_2 Pyr_redox Pyr_redox_3 MCRA GIDA FAD_binding_3 FAD_oxidored Thi4 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ABX07290
JGI: Haur4659
UniProt: A9B1A3
Position
5955196..5956626
Genome map
AA seq 476 aa AA seqDB search
MDVADQPRIAIIGGGIAGLSTAWYLQQQGLTNIQLFERDQRLGGKLRTSHVALPDGAGEL
LVEAGPDAFISQKPWGLQLARELGLEDQLISTEPARHKVFVLHRGKPEPLPDGINLVVPT
EFWPLLRTPILSLPGKLRMLLDLVLPARQSNTDESLADFVRRRFGAEALDKLAEPLMAGI
HNAESDRQSLEATFPRFIEAERSHGSVIRGILAAKLKAGKPKGQQLSPFISLRGGIEQLI
TALVEQLNVEIRTNCGVQALRYDPTNASAYQLTLDDGTKIDADAVVLAVPSFVAAELVAP
WAEALAERLKAIRYVSTGTVSLAFRRSETNMAFDSYGLVIPRSEYRLINAVTINSRKFAG
RAPADYMLLRAFVGGSKHPEVLRLDDQALTQLVRDQLKSIFGLTAEPIWSGVARWNEANP
QYDVGHFQRMDQLEALCPEGLLLCGSGFRGVGIPDCVRQGQATAQAISQLFALANA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgctgatcagccacgcattgccattattggcggtggtatcgctggccttagt
acagcatggtatttacaacaacaaggtctcacgaatattcagctttttgaacgtgatcaa
cggctgggcggcaaattgcgcaccagccatgttgccttgcccgatggcgctggcgaattg
ctggtcgaagctggccccgatgcctttatcagccaaaagccttggggcttgcaattggcg
cgtgagttgggcttggaagatcagttaatttcaactgagccagctcgccataaggtgttt
gtgttgcatcgtggcaagcccgaacccttgcctgatggcattaacttggttgtcccaact
gagttttggccgttgctgcgcacgccgattctctcgctgccaggcaaattgcgtatgttg
ctcgatttggtcttgcctgcccgccaaagtaatactgatgaatcgctggccgattttgtg
cgccgccgatttggggccgaagcgctggataaattggccgagccgttgatggcaggcatt
cacaatgcagaatcggatcgccaaagcctcgaagccacctttccacgctttatcgaggcc
gaacgcagccatggcagtgtgattcgtgggattctggcggctaaacttaaagcaggcaag
cccaaaggtcagcaacttagcccatttattagcttacgcggcgggatcgagcaattaatt
accgcgctggttgagcagctcaacgttgaaattcggacaaattgtggggttcaagcgctg
cgctacgacccaaccaacgcctcagcctatcaactgaccctcgatgatggcacgaagatt
gatgctgatgcagtggtgttggcagtgcctagttttgtggccgctgagttggtcgcacct
tgggctgaagccttggccgagcgcttgaaggcgattcgttatgtcagcactggcacagtt
tcgttggcatttcggcgtagcgaaaccaacatggccttcgatagttatggcttggtgatt
ccgcgcagcgaatatcggctgattaatgctgtaacgatcaactcacgcaaatttgctggg
cgtgctcccgccgattatatgctgttgcgggcctttgtgggcggctcgaaacatcccgaa
gtgctgcgcttggatgatcaggcattaactcaattggtgcgtgatcagcttaaatcgatt
tttggcctgaccgccgagccaatttggagcggggttgcccgttggaacgaggctaatccc
caatacgatgttggtcatttccaacgtatggatcagcttgaggccttgtgtccagaaggc
ttgttgttgtgtggcagcggctttcggggcgtgggcattcccgattgtgtgcgccaaggc
caagcaaccgctcaggccattagccaattgttcgctttggctaacgcttaa

DBGET integrated database retrieval system