KEGG   Herpetosiphon aurantiacus: Haur_4857Help
Entry
Haur_4857         CDS       T00614                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hau  Herpetosiphon aurantiacus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hau00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6192116..6193018)
Genome map
AA seq 300 aa AA seqDB search
MTHTTPDNFLGLDQQYSTLETSKVVVLPIPFEATVSYGGGTVNGPSAIIEASQQVEFYDR
EFDTEPAKNWGVHTLPSVEVNDQDPDSAMQSIAQAVEATARLGKLVCVLGGEHSVSGAVA
QGLHAVHGDFVTVQIDAHADLRDQYEGSKHSHACAMHRILDVGAGDLLQLGIRSLDISEA
HMIKTDPRITTFYSEHVHDGLHLPALRDFVRGKQVYFTIDIDGLDVGLVPATGTPEPDGL
TWREVLEITRILVQESAKVVAFDIMELAPIENLHSPNFVSAKLTYKVMSIIMAKQADLWQ
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacccatactactcccgataattttttgggcttagatcagcagtatagcacgctggag
accagcaaagtggtagttttgcccatcccctttgaggctactgtgagttatggcggtggc
acggtcaatgggccaagcgcgattatcgaggcttcgcaacaggtcgaattttatgatcgt
gaattcgatactgagccagccaaaaattggggcgtgcacaccttgcccagcgtcgaggtc
aacgatcaagaccctgatagcgctatgcaaagcatcgcccaagcagttgaagcaaccgca
cggttgggcaaattggtgtgtgtactgggcggcgagcattcagtttcaggcgcggtcgcg
caaggtctccacgcagtacatggcgattttgtgacggtgcaaattgatgctcacgccgat
ttgcgcgatcaatatgagggcagcaaacactcccacgcttgtgccatgcaccgaattctc
gatgttggcgctggcgatttgttgcaattgggcattcgatcattggatatcagcgaagcc
catatgatcaaaactgacccacggattacgactttttatagtgaacatgtgcatgatggg
ctacatttgccagccttgcgcgattttgtacggggcaaacaagtctattttacaatcgat
attgatggcttagatgttggtttagtacctgcgactggcacgcctgaacccgatggcctg
acatggcgcgaagtactcgaaattacccgtattctagtgcaagaatcggccaaggtcgtg
gcctttgatataatggaattagcaccaattgaaaatttacattcgccaaattttgttagt
gccaagctcacctacaaggttatgagcattatcatggccaaacaagctgatttatggcaa
tag

DBGET integrated database retrieval system